KEGG   Bos indicus (zebu cattle): 109557962Help
Entry
109557962         CDS       T04792                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00052  Galactose metabolism
biu00500  Starch and sucrose metabolism
biu01100  Metabolic pathways
biu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109557962 (MGAM2)
   00500 Starch and sucrose metabolism
    109557962 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109557962 (MGAM2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109557962 (MGAM2)
    3.2.1.20  alpha-glucosidase
     109557962 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109557962
NCBI-ProteinID: XP_019815043
LinkDB All DBs
Position
4
AA seq 2226 aa AA seqDB search
MARKLSALEILLIIFIIIVLAVDILFLMLLLEKPSGASFVPECPEIPESERIDCAPGQEV
TEDVCRQRYKCCWKPVPDTAIPWCFFPRNWGYEISNLVKNTSTEYEAQLRRLPSPSLFGY
DVIDTLFRAEYQTSNRFHFKITDFNNMRYEVPHENVKLFDGNADASNLSYHLEVIHKPFS
IKIMRASNKRVLLDTSIGPLQFAQQYLQLSMRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVTLQPAPAVTYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRNYGGIDGLKNVVNRTREAEI
PYDVQYSDIDYMDEKKDFTIDGVAFSGLPGFAKELHKNGLKYVIIMNPGILNNSDYQPYA
NGSRKRVWILGDKGFVVGQAYPGWTVFPDFTNPDCTEWWKEQFSEFYKTLEFDGVWIEMD
EVSSFLQSSDQDCEVNNFNFPPFKPRVLDHLLFARTLCMDTEFHGGFHYDVHSLYGYTMA
KATDSAMENIFSNKRRFILSRSTFAGSGKFAAHWLGDNAARWDDLRWSIPGILEFNLFGI
PMVGANICGYRENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNAMLLESSR
YYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVL
YEGLNYARAYIPDAIWYDYETQVAIEWRKQFVEMLLPGDRIGLHLRGGYIFPIQQPNTTT
ETSRKNSLGLIIALDSKREAKGELYWDDGVSKDAVTGNNYILYXFSITSNRLQATIIHAN
YTDPDKLTFTDIMILGMDKEPTNFTVSLNDVTTSISNVVYTESTKVVNITDLEGLVLGQA
FSIQWDLPVSDLQKFNCFPEQPAVSEESCRERGCLWEPTTVPGVPTCFYDTIPNYAASNI
QYLPTGITVDLTHLTASEAGQATVPAPSSRDKLSPPAAAAKAASASDTLSATIGFLRLSV
TYHTENMLQFKIYDPTNKRYEVPVPLNTPSSPVGSPENCLYDVKIQNNPFGIQIRRKSSS
TVIWDSQLPGFTFRDMFLSISTRLPSQYLYGFGETEHTTFRRNISWHTWGMFARDEPPXY
KKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTP
ELVTQQYTELIGRPAMIPYWALGFQLSRYGYQDDYEISSLYVAMMAAQIPYDVQHVDIDY
MDRKLDFTLSPSFQNLGXLIEQMKKNGTRFVLVLDPAISGNETQYLTFTRGKESDVFIKW
PDNSDIVWGKVWPDLPNVNVDGSLDHETQVKLYKAHVAFPDFLRNSTAAWWKREIEELYR
NPREPEKSLKFDGLWINMNEPSNFVNGSVRGCSDEILNNPPYVPYLESRDRGLSSRTLCM
ESQQVLPDGSPVRHYDVHSHYGRAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWL
GDNRAAWDQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNH
NTFGTRRQDPVAWDSXFEMFSRKVLQTRYTLLPYLYTLMHKAHAEGSTVVRPLLHEFTEE
RTTWDIDHQFMLGPAVLISPVLENNTFQVQAYFPRARWYDYSTGSGNESTGEWKVLEAPL
DHINLHIRGGYILPWQEPAMNTYSSRQKYMGLIVALDDNGRAEGQLFWDDGQSIDTFENG
NYFLVNFTAAQSVLQIQMIHNNYLSDTNSLKVGYIRIWGINSTDITQVTVSYDNQQFMVM
NFKSDPYNQTLNIQLTDKIISLEKLXEITWIHGGPIVSTTTMTSTFPMSSLHPPTTSTTA
ATSVTTSSSTPSSTSTTDSSSAALPMTTTSFPTSATEVSTGTTVPNTSTSFPTNTATDST
SVILPITTMHYPTSATEVSTSVTVPNTTISSPIHTTLDSTDSTLPITDTPYTTSATQVLT
STTVPNATVSSPINTTTDTTDITLXITDTPSTTSATQVSTSTTVPNATISSPINTTTHST
NVTLPVTTXXXXXXXXXXXXXTTVPNATISSPINTTTDSTNVTLPVTTMSYITTTAEVST
STTVPNATVSSPINTTXDSTNVTLPVTTMXYTTSTAEVSTTTTFXNATISSPIYTTLDST
NVTLHITDTPYTTSATQVSTSTTVPNATISSPINTTTDSTILTLSVTTMLYPTNTAADTT
SNSFLL
NT seq 6681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagcttagtgcattggaaatcctcctgatcatcttcatcataattgtactt
gctgtagatatcctctttctgatgcttctgttggagaagccttcaggtgcttcatttgtt
ccagagtgcccagaaatccccgaatcagaaaggatagactgtgcccctggccaggaggtg
acagaggatgtctgccgacagagatataagtgctgctggaaacctgtgccagatactgcc
atcccctggtgcttcttccccaggaactggggctacgaaatcagcaatttggttaaaaat
acaagcacagagtatgaggcccagttgagaaggctgccatcaccatctctgtttggatat
gatgtaatcgacaccctcttcagagctgaatatcagacatccaatcgtttccattttaag
atcactgatttcaataacatgcgctatgaagtcccccatgaaaatgttaagctctttgat
gggaatgctgatgcttccaatttgagctatcatctagaagtcattcacaaacccttcagc
atcaagataatgagggccagcaacaaaagagtcttgttggacaccagcattgggcccctc
cagtttgcccagcagtacctgcagctctccatgcgactgcccagtgccaacgtgtacggg
ctgggcgaacacgtgcaccagcagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgggacgccacccctaccgagggcatgattaatctatatggagctcacacattc
ttcttgtgcctagaagacaccagcggcttctctttcggggtttttctgatgaacagtaac
gccatggaggtcacccttcagcccgctcctgccgtcacttaccgcacgatcgggggtatt
cttgacttctatgtgttcctgggaaatactccagaacaagtggttcaggaatatctggag
cttgttggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcagg
aattatggtggtattgatggattgaaaaatgttgtaaaccgaactcgtgaagctgagatc
ccttatgatgtccagtactctgacatagactacatggatgaaaagaaggatttcactatt
gatggagtggccttctctggtctcccaggttttgccaaagagttacataaaaatggactg
aaatatgtaattattatgaatcctggcatcttaaataactctgactaccagccttatgcg
aatggaagcagaaagagagtgtggatcttgggggacaaaggctttgttgttgggcaggca
tatcctggctggacagtttttcctgattttactaatccagattgtactgagtggtggaaa
gagcagttcagtgaattttataaaactctggagtttgatggagtgtggattgaaatggat
gaagtatctagctttctacaaagttctgatcaagactgtgaagtaaacaacttcaacttt
cctcctttcaaacctcgagttctggatcacttgcttttcgcaagaaccctctgcatggac
acagagtttcatgggggctttcactacgatgtccacagcttgtatggctacaccatggca
aaagccacagactcggccatggagaatatcttcagcaataagagacgcttcatcttatca
cgttctacttttgcgggatctggcaaatttgctgctcattggttgggggacaatgcagcc
agatgggacgatctccgatggtccatccctggtatcttggagttcaacctattcggcatc
cccatggtaggtgccaacatctgtggttatagagagaatgtcacagaggagctttgcaga
cggtggatgcagctgggagcattttatccactgtcgaggaatcacaacgggcctggattc
agggaccaggatcctgctgccttcagtgaaaacaacgctatgctgctggaatcctccaga
tactatctgaacatccgctacaccctgctgccctatctctacacccttttctaccgagct
cataccctgggggagaccgtagcaaggcccctcgtccacgagttctaccaggacccagcc
acctgggaggtgcacgagcagttcctctgggggcctggactcctcatcacgcctgtttta
tatgaaggtttgaactatgcaagagcatacatacccgacgccatctggtacgactatgaa
acgcaagtagccatagaatggaggaaacaatttgtggagatgctgctgccaggtgatagg
ataggacttcacctccgagggggctacatctttcccatccagcagccaaacacgaccaca
gagaccagccggaagaactctctgggactcatcattgccttggactctaagcgagaagca
aagggagagctgtactgggatgatggtgtctctaaagatgctgtaactggaaataattat
attctgtataasttttccatcacctctaaccgtctacaggcaacgattatacatgctaat
tatacagaccctgacaaactcacatttacagatatcatgatcttgggaatggacaaggaa
cctactaattttactgtctccctaaatgatgtgaccacctccatttcaaatgttgtctac
acagaatcaacaaaggtggtgaacatcactgaccttgagggactggtactgggacaagca
ttctccattcagtgggatcttccagtcagtgacctgcagaagttcaactgctttcctgag
cagcccgctgtctccgaggagagttgcagggagcgggggtgcctttgggagcccacgact
gttcctggggtgcccacctgtttctatgacaccatccctaattatgctgccagcaacatt
cagtacctgcctacgggcatcactgtagacctcacccacctgacagcctcagaagctgga
caagctacggtgccagcaccatcatcacgggacaagctatccccacctgcagccgcagcg
aaggccgcctctgcctctgacactctctctgcaaccatcggctttctccgcctgagcgtg
acctaccacacagagaacatgctgcagttcaagatctatgatcccactaataaaaggtac
gaggtcccagtgcctctgaacaccccttcgtctccagtgggctcccctgaaaactgtctg
tatgatgtcaagattcagaacaatccttttgggatccagattcgaagaaagagctccagc
actgtgatttgggactctcagctccctggcttcaccttcagggacatgttcctttccatc
tccacacgcctcccctctcagtacctctatggctttggggaaactgagcacacaactttc
agaagaaacataagctggcacacatggggaatgtttgcccgagatgagccaccagygtat
aagaagaactcctatggtgtccayccctactayatggcactggaggaggatggcagtgcc
catggagtgctcctgctgaacagcaatgccatggatgtgacattccagcctactcctgcc
ctgacataccgcaccacaggaggcattttggacttttatatggttttggggccaacccct
gagcttgtaactcarcaatacactgagttgattggtcggccagcaatgattccttactgg
gccttgggattccaactgagtcgctatggataccaggatgattatgaaatctccagtttg
tatgttgcaatgatggctgctcagattccctacgatgtccagcatgtcgacatcgactac
atggaccggaagctggacttcactctcagccccagctttcaaaatcttggccycctgatt
gagcaaatgaagaaaaatggcacaagatttgttcttgttctggacccagccatttctggc
aatgagacccagtatctcacattcaccagagggaaggaaagtgatgtgttcatcaaatgg
ccagacaacagcgatattgtctggggaaaggtttggccagatctgcccaacgtgaatgtg
gatgggtcccttgatcacgaaactcaggttaagttgtacaaagcccacgttgcttttcct
gacttcttgcggaacagcactgctgcctggtggaagagggaaatagaagagctctacaga
aaccctcgagagccagagaagagcttgaagtttgatggattgtggattaacatgaatgaa
ccatcgaactttgtraatggatctgtcaggggctgcagtgatgaaattcttaataatcca
ccctatgtgccatacttggagtcccgggaccggggcctgagcagcaggaccctgtgcatg
gagagccagcaggtgctgcccgatggctcaccggtgcgccactacgatgtgcacagccat
tatggcagggcccagaccagacccacgtacgaagctgtgcaggaggtgacgggacagcga
gggatcgtcatcactcgctccactttcccctcttctggccgctggggaggacactggctg
ggtgacaacagggccgcgtgggaccagctgaagaagtcaatcattggcatgatggaattc
agtctctttggaatctcttatacaggagcagacatctgtggattctttggagatgctgag
tatgagatgtgtgttcgctggatgcagctgggggcgttttatccattttccaggaaccac
aacacattcgggaccaggagacaagatcctgtggcctgggactcagmctttgagatgttc
tcaagaaaagtcctccagaccagatatactctgctgccytacctctatactctgatgcat
aaggctcacgctgagggcagcactgtggtccgaccccttctccatgagtttacagaggag
cgcacaacatgggatatagaccatcarttcatgctgggccctgccgtcttaattagcccc
gtgctggaaaataacacttttcaggtccaggcttactttcccagagcccgttggtatgac
tacagcacgggatctggcaatgaatcaacaggtgagtggaaagtcctggaggctcccctg
gaccatatcaaccttcatatcagaggaggctacatcctgccttggcaagaacctgcgatg
aacacttactccagccgacagaaatatatgggattgattgttgctttggatgataatggg
agagctgaaggtcagctgttctgggatgatggacaaagcattgatacctttgaaaatgga
aactatttcttggtaaactttacagcagctcagagtgtactgcaaatccaaatgatacat
aataattatttgagtgacactaattcactgaaagttggatatattagaatctggggcata
aactctactgatataacacaagtgactgtctcctatgacaatcaacaattcatggtgatg
aatttcaagagtgacccttacaatcagacactaaatattcaactgactgacaagattatc
agcctggaaaagttarctgagattacttggattcacggtggtcctatagtttctactaca
actatgacgagtaccttcccaatgagttctttacatcctcctacaacttctactactgct
gctacttctgttaccactagttcttctactccaagtagcactagtactactgatagcagt
agtgctgctcttcctatgacaaccacttcttttccaacaagtgccactgaggtttcaact
ggtactaccgttcccaataccagtacatctttccctacaaatactgctactgatagcact
agtgttattcttcccatcacaaccatgcattacccgacaagtgctactgaagtttcaact
agtgttactgtccctaataccactatatcttcccctatacatacractctggatagcact
gatagtactcttcctatcacagacacgccatacacaacaagtgctactcaagttttaact
agtactactgtccctaatgccactgtatcttcccctataaatactactactgataccact
gatattactcttmctatcacagacacgccatccacaacaagtgctactcaagtttcaack
agtactactgtccctaatgccactatatcttcccctataaatactactactcatagcact
aatgttactcttccagtcacaaccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
ngtactactgtccctaatgccactatatcttcccctataaatactactactgatagcact
aatgttactcttccagtcacaaccatgtcttacataacaactactgctgaagtttcaact
agtactactgtccctaatgccactgtatcttcccctataaatactactrytgatagcact
aatgttactcttccagtcacaaccatgscttatacaacaagtactgctgaagtttcaact
actactactttccytaatgccactatatcttctcctatttatactactctggatagcact
aatgttactcttcatatcacggacaccccatacacaacaagtgctactcaagtttcaact
agtactactgtccctaatgccactatatcttcccctattaatactacgaccgatagcact
attcttactctttctgtcacaaccatgctttacccaacaaatactgctgctgatactact
agcaatagttttctattgtga

DBGET integrated database retrieval system