KEGG   Bos indicus (zebu cattle): 109558039Help
Entry
109558039         CDS       T04792                                 

Gene name
IQCA1L
Definition
(RefSeq) IQ and AAA domain-containing protein 1-like
Organism
biu  Bos indicus (zebu cattle)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ AAA_16
Motif
Other DBs
NCBI-GeneID: 109558039
NCBI-ProteinID: XP_019815084
LinkDB All DBs
Position
4
AA seq 819 aa AA seqDB search
MSEAAYQRLWDSSHLILEELLDQEPLLGEAVSESERQPFQYRLSSLYLHYLGLLRRFDTL
YDQMVQPQKRRLLRRLLDSVACRVLELKDDLVRADLCETHCLDQVXQDLKLTPADLEVPI
PRYFELERSSILKEREHMLVELLSRLKPEISEXSFPILSRTEAIILLQKAERARQGRLRA
TFMREIRKEEERDRKIREEGRFKFSQDEAAVTIQKVWKGYLQRKRTQQDRRTEMEFIGML
PSASPVEPMGARSQASLGADVRRLRQTEKEEEFQLAVVKAHDHLREVXGPDMKEKMKEQI
RQWFIECHALTGRFPDYPDESLGGSSLIFADKTPEQVRMELEVQVQENKKKEQEKSKEKE
KEEEEKQKKKGEKTKKGEADTMLRALPSKSVPAINAGHKEYTNLWKNRFDSLFPSQSFDS
ETLKIEERKDVEQEIRIQVDDLMRQELKNLRLAVDREETRPVKPPKKKAGKKPGKKKKEK
DLTPDRPMDSLFEELVVLGLLKKSETVPLKDYIGDCLYLGSALNLANKLPMXSLADIRQN
MALYGILRLGSPDIHSMAPLIRSILLVGPSGMGKKMLVKAVCTETGANLFDLSPENLQGK
YPGKTGVQMLVHVVFKVARYLQPSVIWIGNAEKTFYKRVPKEEEEMDPKRIKKDLTKALR
LLSPGDRVMLIGTTDRPQVAEMKGLCRTYERILLLPRPDYASRYVLWRHMIEAQGAQGTQ
HLDISALAKVSDGYTAGCILQAIQAVLTERRLLQLSKRPLLTSEFLGPLAKLDPVYREEE
ESLKDWYFKTPLGKKRMKLLKDQDAAEEAKLAKEKKKKK
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggcagcttaccagcgcctctgggactcctcccacctgatcttggaagagctt
ctggaccaggagccactgctgggggaagccgtttccgagagcgaacggcagcccttccag
taccggctctcctcgctctatctgcactacctggggctgctgcgccgcttcgacaccctt
tatgaccagatggtgcagccgcagaagcggcggctgctgcggcgcctgctggacagcgtg
gcctgccgcgtgctggagctcaaagacgatctggttcgcgccgacctgtgtgagacccac
tgcctggaccaagtccygcaggacttaaagctcaccccggcagacctggaggttccgatt
cccaggtatttcgagctggagcggtccagcatcctgaaggagcgagaacacatgctggtg
gagctgctgtccagactgaagccagagatctcagagkggagctttccaatattaagccgg
actgaggccataatcctactgcaaaaggccgagcgggccaggcaaggcaggctccgggcc
accttcatgcgggagattcggaaagaggaggagcgagaccggaagattcgggaggaaggt
cggttcaagttcagtcaggacgaagcagccgtcaccatacagaaggtatggaagggttac
ctgcagaggaaacgaactcagcaggaccggcgaaccgagatggagttcatcggcatgctc
ccctcagccagcccggtggagcccatgggcgcccggtcccaggccagcctcggggcagat
gtgcgcaggctccggcagaccgagaaggaggaggagttccagctggctgtggtgaaggcc
cacgaccacctcagggaggtggangggcccgacatgaaggagaagatgaaggagcagatc
cgacagtggttcattgagtgccatgccctcaccggccgattccctgattatccagacgag
tctttaggtggatcctccctgatctttgcagacaagactccagaacaggtgaggatggaa
ctggaggtgcaagtccaggagaacaaaaaaaaagagcaagagaaaagtaaggagaaagaa
aaggaggaagaagagaaacagaagaagaagggagaaaagaccaagaagggagaagcggac
acgatgcttagagcactgccttccaaatccgtccctgcgattaacgccggccacaaggag
tacacgaatctgtggaagaaccggtttgacagcctctttcccagccagagttttgactct
gagaccctcaagatagaagagaggaaagacgtggaacaggaaatccggatacaggtggat
gatctgatgcgtcaggagctgaagaacctgaggctggccgtggacagggaggagacgaga
cccgtgaagcctccaaagaagaaggcgggcaagaaacctgggaagaagaagaaggaaaaa
gacctgaccccagacaggcctatggactccctgtttgaagagctcgtcgtyttaggcctt
ctaaagaagagcgagacagtgcccttgaaagactacattggtgactgcctctatctcgga
tcggctctgaacttggcaaacaagctgcctatgycctccctggctgacatccggcagaac
atggccttgtatgggattctgcggctaggctccccagatatacactccatggctcccctc
atccgctccatcctcctggtgggtccctccggtatgggcaagaagatgctggtgaaggcc
gtatgcacggagaccggtgccaaccttttcgacctgtcgccggagaacctgcagggcaaa
taccccggcaagactggggtgcagatgctggtgcacgttgtctttaaggtggctcgatac
ctacagccttctgtgatctggattgggaatgcggagaagactttctacaaacgagtcccc
aaagaagaggaggagatggacccaaagcgaataaagaaggacctcaccaaggccctgcgg
ctgctgagtcccggggaccgcgtgatgctgatcgggaccaccgaccggccgcaggtggcc
gagatgaagggcctttgccgcacctacgagcgcatcctcctcctgcctcggcccgattat
gcctctcgctatgtgctctggaggcatatgatcgaggcccagggagcccaggggacccag
cacctggacatcagtgccctggccaaggtgtctgacggctacacagctggctgcatcctc
caagccatccaggcagtgctgaccgagcggcggctcctgcagttgtccaagaggcccctc
ctgacctcagagttcctggggcctctggcaaagctggacccggtgtacagggaggaggag
gagtccctgaaggactggtacttcaagaccccactgggcaagaagaggatgaagcttctc
aaggaccaggacgctgctgaggaagccaagctggcaaaggagaagaagaagaagaagtga

DBGET integrated database retrieval system