KEGG   Bos indicus (zebu cattle): 109558077
Entry
109558077         CDS       T04792                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01523  Antifolate resistance
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04657  IL-17 signaling pathway
biu04659  Th17 cell differentiation
biu04668  TNF signaling pathway
biu04672  Intestinal immune network for IgA production
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05010  Alzheimer disease
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05135  Yersinia infection
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
biu05332  Graft-versus-host disease
biu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109558077 (IL6)
   04668 TNF signaling pathway
    109558077 (IL6)
   04066 HIF-1 signaling pathway
    109558077 (IL6)
   04068 FoxO signaling pathway
    109558077 (IL6)
   04151 PI3K-Akt signaling pathway
    109558077 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109558077 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109558077 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109558077 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109558077 (IL6)
   04620 Toll-like receptor signaling pathway
    109558077 (IL6)
   04621 NOD-like receptor signaling pathway
    109558077 (IL6)
   04623 Cytosolic DNA-sensing pathway
    109558077 (IL6)
   04625 C-type lectin receptor signaling pathway
    109558077 (IL6)
   04659 Th17 cell differentiation
    109558077 (IL6)
   04657 IL-17 signaling pathway
    109558077 (IL6)
   04672 Intestinal immune network for IgA production
    109558077 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558077 (IL6)
   05202 Transcriptional misregulation in cancer
    109558077 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109558077 (IL6)
   05321 Inflammatory bowel disease
    109558077 (IL6)
   05332 Graft-versus-host disease
    109558077 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109558077 (IL6)
   05020 Prion disease
    109558077 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    109558077 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109558077 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109558077 (IL6)
   04931 Insulin resistance
    109558077 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109558077 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109558077 (IL6)
   05135 Yersinia infection
    109558077 (IL6)
   05133 Pertussis
    109558077 (IL6)
   05134 Legionellosis
    109558077 (IL6)
   05152 Tuberculosis
    109558077 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109558077 (IL6)
   05161 Hepatitis B
    109558077 (IL6)
   05171 Coronavirus disease - COVID-19
    109558077 (IL6)
   05164 Influenza A
    109558077 (IL6)
   05162 Measles
    109558077 (IL6)
   05168 Herpes simplex virus 1 infection
    109558077 (IL6)
   05163 Human cytomegalovirus infection
    109558077 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109558077 (IL6)
   05169 Epstein-Barr virus infection
    109558077 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109558077 (IL6)
   05144 Malaria
    109558077 (IL6)
   05142 Chagas disease
    109558077 (IL6)
   05143 African trypanosomiasis
    109558077 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109558077 (IL6)
   01523 Antifolate resistance
    109558077 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109558077 (IL6)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109558077 (IL6)
SSDB
Motif
Pfam: IL6 MAP65_ASE1 IL23 GCSF ADIP Lipoprotein_6 ZapB
Other DBs
NCBI-GeneID: 109558077
NCBI-ProteinID: XP_019815115
UniProt: A0A6P5BRN2
LinkDB
Position
4
AA seq 187 aa
MTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRMVDKISAMRKEICEKNDECESS
KETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLLEYQIYLDYLQNEYEGNQENVR
DLRKNIRTLIQILKQKIADLITTPATNTDLLEKMQSSNEWVKNAKIILILRNLENFLQFS
LRAIRMK
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacttctgctttccctaccccgggtcccctgggagaagatttcaaaaatgacaccacc
ccaggcagactacttctgaccactccagagaaaaccgaagctctcattaagcgcatggtc
gacaaaatctctgcaatgagaaaggagatatgtgagaagaatgatgagtgtgaaagcagc
aaggagacactggcagaaaataagctgaatcttccaaaaatggaggaaaaggacggatgc
ttccaatctgggttcaatcaggcgatttgcttgatcagaaccactgctggtcttctggag
tatcagatatacctggactacctccagaacgagtatgagggaaatcaggaaaatgtcagg
gatttgaggaaaaatatcagaacactgatccagatcctgaagcaaaagatcgcagatcta
ataaccactccagccacaaacactgacctgctggagaagatgcagtcttcaaacgagtgg
gtaaagaacgcaaagattatcctcatcctgagaaaccttgagaatttcctgcagttcagc
ctgagagctattcggatgaagtag

DBGET integrated database retrieval system