KEGG   Bos indicus (zebu cattle): 109558077
Entry
109558077         CDS       T04792                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01523  Antifolate resistance
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04657  IL-17 signaling pathway
biu04659  Th17 cell differentiation
biu04668  TNF signaling pathway
biu04672  Intestinal immune network for IgA production
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05010  Alzheimer disease
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05135  Yersinia infection
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
biu05332  Graft-versus-host disease
biu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109558077 (IL6)
   04668 TNF signaling pathway
    109558077 (IL6)
   04066 HIF-1 signaling pathway
    109558077 (IL6)
   04068 FoxO signaling pathway
    109558077 (IL6)
   04151 PI3K-Akt signaling pathway
    109558077 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109558077 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109558077 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109558077 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109558077 (IL6)
   04620 Toll-like receptor signaling pathway
    109558077 (IL6)
   04621 NOD-like receptor signaling pathway
    109558077 (IL6)
   04623 Cytosolic DNA-sensing pathway
    109558077 (IL6)
   04625 C-type lectin receptor signaling pathway
    109558077 (IL6)
   04659 Th17 cell differentiation
    109558077 (IL6)
   04657 IL-17 signaling pathway
    109558077 (IL6)
   04672 Intestinal immune network for IgA production
    109558077 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558077 (IL6)
   05202 Transcriptional misregulation in cancer
    109558077 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109558077 (IL6)
   05321 Inflammatory bowel disease
    109558077 (IL6)
   05332 Graft-versus-host disease
    109558077 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109558077 (IL6)
   05020 Prion disease
    109558077 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    109558077 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109558077 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109558077 (IL6)
   04931 Insulin resistance
    109558077 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109558077 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109558077 (IL6)
   05135 Yersinia infection
    109558077 (IL6)
   05133 Pertussis
    109558077 (IL6)
   05134 Legionellosis
    109558077 (IL6)
   05152 Tuberculosis
    109558077 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109558077 (IL6)
   05161 Hepatitis B
    109558077 (IL6)
   05171 Coronavirus disease - COVID-19
    109558077 (IL6)
   05164 Influenza A
    109558077 (IL6)
   05162 Measles
    109558077 (IL6)
   05168 Herpes simplex virus 1 infection
    109558077 (IL6)
   05163 Human cytomegalovirus infection
    109558077 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109558077 (IL6)
   05169 Epstein-Barr virus infection
    109558077 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109558077 (IL6)
   05144 Malaria
    109558077 (IL6)
   05142 Chagas disease
    109558077 (IL6)
   05143 African trypanosomiasis
    109558077 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109558077 (IL6)
   01523 Antifolate resistance
    109558077 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109558077 (IL6)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109558077 (IL6)
SSDB
Motif
Pfam: IL6 MAP65_ASE1 IL23 GCSF ADIP Lipoprotein_6 ZapB
Other DBs
NCBI-GeneID: 109558077
NCBI-ProteinID: XP_019815115
UniProt: A0A6P5BRN2
LinkDB
Position
4
AA seq 187 aa
MTSAFPTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRMVDKISAMRKEICEKNDECESS
KETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLLEYQIYLDYLQNEYEGNQENVR
DLRKNIRTLIQILKQKIADLITTPATNTDLLEKMQSSNEWVKNAKIILILRNLENFLQFS
LRAIRMK
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacttctgctttccctaccccgggtcccctgggagaagatttcaaaaatgacaccacc
ccaggcagactacttctgaccactccagagaaaaccgaagctctcattaagcgcatggtc
gacaaaatctctgcaatgagaaaggagatatgtgagaagaatgatgagtgtgaaagcagc
aaggagacactggcagaaaataagctgaatcttccaaaaatggaggaaaaggacggatgc
ttccaatctgggttcaatcaggcgatttgcttgatcagaaccactgctggtcttctggag
tatcagatatacctggactacctccagaacgagtatgagggaaatcaggaaaatgtcagg
gatttgaggaaaaatatcagaacactgatccagatcctgaagcaaaagatcgcagatcta
ataaccactccagccacaaacactgacctgctggagaagatgcagtcttcaaacgagtgg
gtaaagaacgcaaagattatcctcatcctgagaaaccttgagaatttcctgcagttcagc
ctgagagctattcggatgaagtag

KEGG   Bos indicus (zebu cattle): 109558717
Entry
109558717         CDS       T04792                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109558717 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109558717 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109558717 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    109558717 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109558717 (IL22)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109558717 (IL22)
SSDB
Motif
Pfam: IL22 IL10 FlaC_arch
Other DBs
NCBI-GeneID: 109558717
NCBI-ProteinID: XP_019815609
UniProt: A0A6P5BS56
LinkDB
Position
5
AA seq 190 aa
MAALQKSVXSPLRDTLAAGCLLVMVLCAQXGAAAPIXSHCRLNESDFQEPYIFNHTFTLA
QXASLADNITDVRLIGNKLXHGIHQVTKRCYVLKQVLNFILEEVLFPQSDKFHPYMEKVV
PFFSRLSKKLSQCHVESDNQHIQRNVQNLKNTVKKLGESGEIKVIGELNLLFTTLKRECA
QVDQGWKMGY
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctgccctgcagaaatctgtgrgctctcctctcagggacactctggccgctggctgc
ctccttgtcatggtgctgtgcgcccagrgaggagcggctgcmcccatcaygtcgcactgt
aggctcaacgagtccgacttccaggagccctacatcttcaaccacaccttcactctggct
cagraggctagtttggcagataacatcacagatgttcgtctcattgggaacaaattgytc
cacggaatccatcaggtgacgaagcgctgctacgtgctgaagcaggtgctgaactttatt
cttgaagaggtgctgttcccccaatctgacaaattccacccctatatggaaaaggtggtg
cccttcttctccaggctcagcaaaaagctaagccaatgtcatgttgagtctgacaaccag
cacatycagagaaatgtacagaatctgaagaacacagtgaaaaagcttggagagagtgga
gagattaaagtcattggagaactgaacttgctgtttacaaccctgaaacgtgaatgtgct
caagtagaccaaggmtggaaaatgggttactaa

KEGG   Bos indicus (zebu cattle): 109558719
Entry
109558719         CDS       T04792                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03050  Proteasome
biu04060  Cytokine-cytokine receptor interaction
biu04066  HIF-1 signaling pathway
biu04217  Necroptosis
biu04350  TGF-beta signaling pathway
biu04380  Osteoclast differentiation
biu04612  Antigen processing and presentation
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05200  Pathways in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    109558719 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109558719 (IFNG)
   04630 JAK-STAT signaling pathway
    109558719 (IFNG)
   04066 HIF-1 signaling pathway
    109558719 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109558719 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109558719 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109558719 (IFNG)
   04612 Antigen processing and presentation
    109558719 (IFNG)
   04660 T cell receptor signaling pathway
    109558719 (IFNG)
   04658 Th1 and Th2 cell differentiation
    109558719 (IFNG)
   04659 Th17 cell differentiation
    109558719 (IFNG)
   04657 IL-17 signaling pathway
    109558719 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109558719 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558719 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109558719 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109558719 (IFNG)
   05323 Rheumatoid arthritis
    109558719 (IFNG)
   05321 Inflammatory bowel disease
    109558719 (IFNG)
   05330 Allograft rejection
    109558719 (IFNG)
   05332 Graft-versus-host disease
    109558719 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109558719 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109558719 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109558719 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109558719 (IFNG)
   05164 Influenza A
    109558719 (IFNG)
   05168 Herpes simplex virus 1 infection
    109558719 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109558719 (IFNG)
   05144 Malaria
    109558719 (IFNG)
   05145 Toxoplasmosis
    109558719 (IFNG)
   05140 Leishmaniasis
    109558719 (IFNG)
   05142 Chagas disease
    109558719 (IFNG)
   05143 African trypanosomiasis
    109558719 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:biu03051]
    109558719 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109558719 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109558719 (IFNG)
Proteasome [BR:biu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109558719 (IFNG)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109558719 (IFNG)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109558719 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 DnaGprimase_HBD Cep57_MT_bd PRANC
Other DBs
NCBI-GeneID: 109558719
NCBI-ProteinID: XP_019815611
UniProt: A0A6P5BEK7
LinkDB
Position
5
AA seq 166 aa
MKYTSYFLALLLCXLLGFSGSYGQGQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWK
DESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ
IPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagctatttcttagctttactgctctgtgkgcttttgggtttttctggt
tcttatggccagggccaattttttagagaaatagaaaacttaaaggagtattttaatgca
agtagcccagatgtagctaagggtgggcctctcttctcagaaattttgaagaattggaaa
gatgaaagtgacaaaaaaattattcagagccaaattgtctccttctacttcaaactcttt
gaaaacctcaaagataaccaggtcattcaaaggagcatggatatcatcaagcaagacatg
tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa
attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg
aatgacctgtcrccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga
ggccggagagcatcaatgtaa

KEGG   Bos indicus (zebu cattle): 109559359
Entry
109559359         CDS       T04792                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu05133  Pertussis
biu05152  Tuberculosis
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109559359 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109559359 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109559359 (IL23A)
   04659 Th17 cell differentiation
    109559359 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559359 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109559359 (IL23A)
   05321 Inflammatory bowel disease
    109559359 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109559359 (IL23A)
   05152 Tuberculosis
    109559359 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109559359 (IL23A)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109559359 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 109559359
NCBI-ProteinID: XP_019816583
UniProt: A0A6P5BTN6
LinkDB
Position
5
AA seq 192 aa
MLGNRAVMLLLLLLLPWTAQGRAVSEDSSPAWTRGQQLSQQLCMLAWSAHLPMGHVDLPR
EEGGDKTTDDVPRIQCEDGCDPQGLRDNSQSCLQRIHRGLVFYEKLLGSDIFTGEPSLLP
BGPVDQLHASILGLRELLQPKGHHWETEQTPSPIPSQPWQRLLLRLKILRSLQAFVAVAA
RVFAHGAATLSP
NT seq 579 nt   +upstreamnt  +downstreamnt
atgctggggaacagagctgtgatgctgctgctgctgctactgctgccctggacagctcag
ggccgggctgtgtcagaggacagcagccctgcttggactcggggccaacagctctcacag
caactctgcatgctggcctggagtgcacacctaccaatgggacatgtggatctaccaaga
gaagaaggaggtgataagactacagatgatgtcccccgtatccagtgtgaggatggctgt
gatccacaaggactcagggacaacagtcagtcctgcttgcaaagaattcatcgaggcctg
gttttttacgagaagctgctgggctcagatattttcacaggggagccttctctactccca
ratggccctgtggaccagcttcacgcctccatactgggcctcagggaactcttgcagccc
aagggtcaccactgggaaactgagcagactccaagccctattcccagccagccatggcag
cgcctccttctccgtctcaagatccttcgaagcctccaggcctttgtggctgtagctgcc
cgggtctttgcccacggagcagcaactctgagcccctaa

KEGG   Bos indicus (zebu cattle): 109561070
Entry
109561070         CDS       T04792                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu05310  Asthma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561070 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561070 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109561070 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561070 (IL9)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561070 (IL9)
SSDB
Other DBs
NCBI-GeneID: 109561070
NCBI-ProteinID: XP_019819056
UniProt: A0A6P5C0D2
LinkDB
Position
7
AA seq 141 aa
MLLAVVLASALFLCSSASQGCFTLTGIRNAVYLIDNLQKDTSSKCSCSTNATDCLCLPIS
SGNCSTACFQEGLSQMSSSTVXTRFHLIVNQLKKIVVTLKSNKCGSFACEQPCNRTTTGN
TLTFLKALLESFQNDRMRGKA
NT seq 426 nt   +upstreamnt  +downstreamnt
atgctcctggctgtggtccttgcctctgccctgttcctctgctcttcagccagccagggg
tgtttcaccttgacagggatcaggaatgctgtgtacctcatcgacaacctgcagaaagac
acgtcttcaaaatgcagctgcagcaccaatgcgactgattgtttgtgtctgcccatttcc
tctggcaactgctccacagcatgcttccaagagggtttgtcacagatgagcagctccaca
gtgarcacgagattccacctgattgtcaaccagctgaagaaaatagtcgtaaccctcaag
agcaacaagtgcggatcttttgcctgtgaacagccatgcaaccgaaccacaacaggcaat
acgctgacatttctgaaggctctgctggaaagtttccagaatgacagaatgagaggcaaa
gcatga

KEGG   Bos indicus (zebu cattle): 109561213
Entry
109561213         CDS       T04792                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04672  Intestinal immune network for IgA production
biu05140  Leishmaniasis
biu05200  Pathways in cancer
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561213 (IL4)
   04151 PI3K-Akt signaling pathway
    109561213 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561213 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561213 (IL4)
   04660 T cell receptor signaling pathway
    109561213 (IL4)
   04658 Th1 and Th2 cell differentiation
    109561213 (IL4)
   04659 Th17 cell differentiation
    109561213 (IL4)
   04657 IL-17 signaling pathway
    109561213 (IL4)
   04664 Fc epsilon RI signaling pathway
    109561213 (IL4)
   04672 Intestinal immune network for IgA production
    109561213 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561213 (IL4)
  09163 Immune disease
   05310 Asthma
    109561213 (IL4)
   05320 Autoimmune thyroid disease
    109561213 (IL4)
   05321 Inflammatory bowel disease
    109561213 (IL4)
   05330 Allograft rejection
    109561213 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109561213 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561213 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561213 (IL4)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561213 (IL4)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109561213 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 109561213
NCBI-ProteinID: XP_019819163
UniProt: A0A6P5C0Z5
LinkDB
Position
7
AA seq 135 aa
MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP
KNTTEKETFCRVGIELRRIYRSHXCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL
LERLKTIMKEKYSKC
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgatcccagtgctggtctgcttactggtatgtaccagtcac
ttcgtccatggacacaagtgtgatattaccttagcagagatcatcaaaacgctgaacatc
ctcacaacgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca
aagaacacaactgagaaggaaaccttctgcagggttggaattgagcttaggcgtatctac
aggagccacaygtgcttgaacaaattcctgggcggacttgacaggaatctcaacagcttg
gcaagcaagacctgttctgtgaatgaagccaagacgagcacaagtacgctgaaagacctc
ttggaaaggctaaagacgattatgaaggagaaatactccaagtgttga

KEGG   Bos indicus (zebu cattle): 109561215
Entry
109561215         CDS       T04792                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04664  Fc epsilon RI signaling pathway
biu05200  Pathways in cancer
biu05310  Asthma
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561215 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561215 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109561215 (IL13)
   04657 IL-17 signaling pathway
    109561215 (IL13)
   04664 Fc epsilon RI signaling pathway
    109561215 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561215 (IL13)
  09163 Immune disease
   05310 Asthma
    109561215 (IL13)
   05321 Inflammatory bowel disease
    109561215 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561215 (IL13)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561215 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 109561215
NCBI-ProteinID: XP_019819164
UniProt: A0A6P5C0P7
LinkDB
Position
7
AA seq 132 aa
MALLLTAVIVLICFGGLTSPSPVPSATALKELIEELVNITQNQKVPLCNGSMVWSLNLTS
SMYCAALDSLISISNCSVIQRTKRMLNALCPHKPSAKQVSSEYVRDTKIEVAQFLKDLLR
HSRIVFRNERFN
NT seq 399 nt   +upstreamnt  +downstreamnt
atggcgctcttattgaccgcggtcattgttcttatctgctttggtggcctcacctcccca
agccctgtgccttctgctacagccctcaaggagctcattgaagagctggttaatatcacc
cagaaccagaaggtgccgctgtgcaatggcagcatggtgtggagcctcaacctgacgagc
agcatgtactgtgcagccctggactccctgatcagcatctccaactgcagtgtcatccaa
aggaccaagaggatgctgaatgcactctgtcctcacaagccctcagctaagcaggtttcc
agtgagtacgtccgagacaccaaaattgaagtggcccagttcttaaaagacctgctcaga
cattcaaggatcgtttttcgcaatgaaagattcaactga

KEGG   Bos indicus (zebu cattle): 109561216
Entry
109561216         CDS       T04792                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04672  Intestinal immune network for IgA production
biu05200  Pathways in cancer
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561216 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561216 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561216 (IL5)
   04660 T cell receptor signaling pathway
    109561216 (IL5)
   04658 Th1 and Th2 cell differentiation
    109561216 (IL5)
   04657 IL-17 signaling pathway
    109561216 (IL5)
   04664 Fc epsilon RI signaling pathway
    109561216 (IL5)
   04672 Intestinal immune network for IgA production
    109561216 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561216 (IL5)
  09163 Immune disease
   05310 Asthma
    109561216 (IL5)
   05320 Autoimmune thyroid disease
    109561216 (IL5)
   05321 Inflammatory bowel disease
    109561216 (IL5)
   05330 Allograft rejection
    109561216 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561216 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561216 (IL5)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561216 (IL5)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109561216 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 109561216
NCBI-ProteinID: XP_019819165
UniProt: B5LVN5
LinkDB
Position
7
AA seq 134 aa
MRMHLHLTLVALGAAYVCANAVESTMNRLVAETLTLLSSHRTLLIGDGNLMIPTPQHTNH
QLCIEEVFQGIDTLKNQTAQGDAVKKIFQNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQ
VFLGVINTEWTMES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcatctgcatttgactttagtagctcttggagctgcttatgtttgtgccaat
gctgtagaaagtaccatgaatagactggtggcagagaccttgacactgctctcctctcat
cgaactctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcac
caactgtgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaa
ggggatgctgtgaaaaaaatattccaaaacttgtctttaataaaagaatacatagacctc
caaaaaaggaagtgtggaggagaaagatggagagtgaaacaattcctagactacctgcaa
gtttttcttggtgtgattaacacagagtggacaatggaaagttga

KEGG   Bos indicus (zebu cattle): 109561218
Entry
109561218         CDS       T04792                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04650  Natural killer cell mediated cytotoxicity
biu04657  IL-17 signaling pathway
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu05146  Amoebiasis
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05171  Coronavirus disease - COVID-19
biu05202  Transcriptional misregulation in cancer
biu05221  Acute myeloid leukemia
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561218 (CSF2)
   04668 TNF signaling pathway
    109561218 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561218 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561218 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    109561218 (CSF2)
   04660 T cell receptor signaling pathway
    109561218 (CSF2)
   04657 IL-17 signaling pathway
    109561218 (CSF2)
   04664 Fc epsilon RI signaling pathway
    109561218 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109561218 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109561218 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109561218 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561218 (CSF2)
   05171 Coronavirus disease - COVID-19
    109561218 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109561218 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109561218 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109561218 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561218 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561218 (CSF2)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     109561218 (CSF2)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109561218 (CSF2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109561218 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 109561218
NCBI-ProteinID: XP_019819167
UniProt: E1AK51
LinkDB
Position
7
AA seq 143 aa
MWLQNLLLLGTVVCSFSAPTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVS
EKFDSQEPTCLQTRLKLYKKGLQGSLTSLMSSLTMMATHYEKHCPPTPETSCGTQFISFK
NFKEDLKEFLFIIPFDCWEPAQK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttctcctgggcactgtggtctgcagcttctccgcacctact
cgcccacccaacactgccacccggccctggcagcatgtggatgccatcaaggaggccctg
agccttctgaaccacagcagtgacactgatgctgtgatgaatgacacagaagtcgtctct
gaaaagtttgactcccaggagccaacgtgcctgcagactcgcctgaagctgtacaagaag
ggcctgcagggcagcctcactagtctcatgagctccttgaccatgatggccacccactac
gagaaacactgcccacccaccccggaaacttcctgtggaacccagtttatcagcttcaaa
aatttcaaagaggacctgaaggagttcctttttatcattccctttgactgctgggaacca
gcccagaagtga

KEGG   Bos indicus (zebu cattle): 109561219
Entry
109561219         CDS       T04792                                 

Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04664  Fc epsilon RI signaling pathway
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05221  Acute myeloid leukemia
biu05310  Asthma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561219
   04151 PI3K-Akt signaling pathway
    109561219
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561219
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109561219
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561219
   04664 Fc epsilon RI signaling pathway
    109561219
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561219
   05202 Transcriptional misregulation in cancer
    109561219
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109561219
  09163 Immune disease
   05310 Asthma
    109561219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561219
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561219
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561219
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109561219
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 109561219
NCBI-ProteinID: XP_019819168
UniProt: A0A6P5C0Z8
LinkDB
Position
7
AA seq 144 aa
MSSLSILHLLLLLLALHAPQAKGLPVVTSRTPYSMLMKEIMDDLKKITPSPEGSLNSDEK
NFLTKESLLQANLKVFMTFATDTFGSDSKIMKNLKEFQPVLPTATPTEDPIFIENKNLGD
FRMKLEEYLVIIRNYLKSKNIWFS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagtctctccatcttgcacctgcttctgctcctgcttgcactccatgctcctcag
gcaaaggggttgcctgtcgtgacatcgaggactccatattctatgttgatgaaggaaatt
atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag
aatttcctgacgaaagagagccttctgcaggcaaacctgaaagtattcatgacatttgcc
acagatacttttggaagcgattcaaaaatcatgaaaaatcttaaggaattccagccagtg
ctgcccacagccacacccacggaagatccaatttttattgagaacaagaacttgggcgat
ttccggatgaaattggaagaatatttggttatcattagaaactatctgaagtccaagaac
atatggttttcctaa

KEGG   Bos indicus (zebu cattle): 109561305
Entry
109561305         CDS       T04792                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04620  Toll-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04940  Type I diabetes mellitus
biu05133  Pertussis
biu05134  Legionellosis
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05162  Measles
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05321  Inflammatory bowel disease
biu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561305 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561305 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109561305 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    109561305 (IL12B)
   04625 C-type lectin receptor signaling pathway
    109561305 (IL12B)
   04658 Th1 and Th2 cell differentiation
    109561305 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561305 (IL12B)
   05205 Proteoglycans in cancer
    109561305 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109561305 (IL12B)
   05330 Allograft rejection
    109561305 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109561305 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109561305 (IL12B)
   05134 Legionellosis
    109561305 (IL12B)
   05152 Tuberculosis
    109561305 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109561305 (IL12B)
   05164 Influenza A
    109561305 (IL12B)
   05162 Measles
    109561305 (IL12B)
   05168 Herpes simplex virus 1 infection
    109561305 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109561305 (IL12B)
   05145 Toxoplasmosis
    109561305 (IL12B)
   05140 Leishmaniasis
    109561305 (IL12B)
   05142 Chagas disease
    109561305 (IL12B)
   05143 African trypanosomiasis
    109561305 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561305 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561305 (IL12B)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561305 (IL12B)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109561305 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_4 Ig_3 fn3 Ig_2 I-set
Other DBs
NCBI-GeneID: 109561305
NCBI-ProteinID: XP_019819240
UniProt: A0A6P5C192
LinkDB
Position
7
AA seq 327 aa
MHPQQLVVSWFSLVLLASPIVAMWELEKNVYVVELDWYPDAPGETVVLTCDTPEEDGITW
TSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQ
KEPKAKSFLKCEAKDYSGHFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAAXLSAEKV
SLEHREYNKYTVECQEGSACPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSAKVTCH
KDANVRVQARDRYYSSFWSEWASVSCS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcaccctcagcagttggtcgtttcctggttttccctggttttgctggcatctcccatc
gtggccatgtgggaactggagaaaaatgtttatgttgtagaattggattggtatcctgat
gctcctggagaaacagtggtcctcacatgtgacactcctgaagaagatggcatcacctgg
acctcagaccagagcagtgaggtcttgggctctggcaaaaccttgaccatccaagtcaaa
gagtttggagatgctgggcagtacacctgtcacaaaggaggcgaggctctgagtcgttca
ctcctcctgctgcacaaaaaggaagatggaatttggtccactgatattttaaaggatcag
aaagaacccaaagctaagagttttttaaaatgtgaggcaaaggattattctggacacttc
acctgctggtggctgacagcaatcagtactgatttgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccgaggggtgacgtgcggagcagcgtygctctcagcagagaaggtc
agcttggagcacagggagtataacaagtacacagtggagtgtcaggagggcagcgcctgc
ccagccgcygaggagagcctgcttattgaggtcgtggtagaagctgtgcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccagacccacccaag
aacctgcaactgagaccattaaagaattctcggcaggtggaggtcagctgggagtaccct
gacacgtggagcaccccgcattcctacttctccctgacgttttgtgttcaggtccaggga
aagaacaagagagaaaagaaactcttcatggaccaaacctcagccaaagtcacatgccac
aaggatgccaacgtccgcgtgcaagcccgggaccgctactacagctcattctggagtgaa
tgggcatctgtgtcctgcagttag

KEGG   Bos indicus (zebu cattle): 109562628
Entry
109562628         CDS       T04792                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562628 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562628 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562628 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562628 (IFNE)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562628 (IFNE)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562628
NCBI-ProteinID: XP_019821215
UniProt: A0A6P5C6L0
LinkDB
Position
8
AA seq 193 aa
MINKAFFEIVLVLLASSTVCSQELKLVLCQQRRVNQESLKLLNKLQTSSVQQCLPHRKHF
LLPQKSVNPHQYQKGQVLAILHEMLQQIFSLFRAIVSLDGWEESHTEKFLVELHQQLEYL
EALMRLQAKQKSDTLGSENLRLQVKMYFQRIHDYLESQDYSSCAWTIVQVEINRCLFLVF
RLTRKLSEQGMET
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattaacaaggctttctttgaaattgtgttggttctgttggcttcttccactgtttgc
tcccaagagctgaaactggttctttgccagcaaaggagagtgaaccaagagagtttaaaa
cttttgaataaactgcagacctcgtcagttcagcagtgtctaccacacaggaaacacttc
ctgcttccccagaagtctgtgaatcctcaccagtatcagaaaggacaagtactggccatt
cttcatgagatgcttcaacagatcttcagcctcttcagggcaattgtatctctggatggt
tgggaggaaagtcacacagaaaagttccttgttgaacttcatcaacagctggaataccta
gaagcactcatgagactgcaagcaaagcagaaaagtgacaccttgggcagtgagaacctt
agattacaggttaaaatgtatttccaaaggatccatgattacctggaaagccaggactat
agcagctgtgcctggactattgtccaagtggaaatcaaccggtgtctgttcttggtattc
cgactcacaagaaagctgagtgaacagggcatggaaacttga

KEGG   Bos indicus (zebu cattle): 109562634
Entry
109562634         CDS       T04792                                 

Definition
(RefSeq) interferon tau-3
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562634
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562634
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562634
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562634
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562634
SSDB
Motif
Pfam: Interferon LuxQ-periplasm
Other DBs
NCBI-GeneID: 109562634
NCBI-ProteinID: XP_019821219
UniProt: A0A6P5C6G7
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGPGRSLGCYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFG
LPQEMVEGSQLQKDQAISVLHEMLQQCFNLFHIEHSSAAWNTTLLEQLCTGLQQQLEDLD
ACLGPVMGEKDSDMGRMGPILTVKKYFQDIHVYLKEKEYSDCAWEIIRVEMMRALSSSTT
LQKRLRKMGGDLNSL
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacggcccgggacga
tctctgggttgttacctgtctgaggaccacatgctaggtgccagggagaacctcaggctc
ctggcccgaatgaacagactctctcctcatccctgtctgcaggacagaaaagactttggt
cttcctcaggagatggtggagggcagccagctccagaaggatcaggctatctctgtgctc
cacgagatgctccagcagtgcttcaacctcttccacatagagcactcgtctgctgcctgg
aacaccaccctcctggagcagctctgcactgggctccaacagcagctggaggacctggac
gcctgcctgggcccagtgatgggagagaaggactctgacatgggaaggatgggccccatt
ctgactgtgaagaagtacttccaggacatccatgtatacctgaaagaaaaggaatacagt
gactgcgcctgggaaatcatcagagtggagatgatgagagccctctcttcatcaaccacc
ttgcaaaaaaggttaagaaagatgggtggagatctgaactcactttga

KEGG   Bos indicus (zebu cattle): 109562635
Entry
109562635         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562635
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562635
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562635
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562635
SSDB
Motif
Pfam: Interferon DALR_2
Other DBs
NCBI-GeneID: 109562635
NCBI-ProteinID: XP_019821220
UniProt: A0A6P5C6L5
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSPNHVLVGRQNLRLLGQMRRLSPRLCLQDRKDFA
FPQEMVEVSQXXXAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLD
ACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTS
LQERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctatggcccgggagga
tccctgggctgtgacttgtctccgaaccacgtgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttatgtctgcaggacagaaaagactttgct
ttcccccaggagatggtggaggtcagccagnnnnnnnaggcccaggccatttctgtgctc
catgagatgctccagcagagcttcaacctcttccacaaagagcgctcctctgctgcctgg
gacactaccctcctggagcagctcctcactggactccatcagcagctggatgacctggat
gcctgtctgggcctgttgactggagaggaagactctgccctgggaaggacgggccccaca
ctggccatgaagaggtacttccagggcatccatgtctacctgcaagagaagggatacagc
gactgtgcctgggaaatcgtcagactggaaatcatgagatccttgtcttcatcaaccagc
ttgcaagaaaggttaagaatgatggatggagacctgaattcaccttga

KEGG   Bos indicus (zebu cattle): 109562636
Entry
109562636         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like isoform X1
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562636
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562636
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562636
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562636
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562636
SSDB
Motif
Pfam: Interferon DUF4205 DIRP
Other DBs
NCBI-GeneID: 109562636
NCBI-ProteinID: XP_019821221
UniProt: A0A6P5C6H2
LinkDB
Position
8
AA seq 218 aa
MASENLPQGSTRRRLSQPSSSLIFPMAVMLSLLMALVLVSYGLGGSLGCDLSQNHMLVGR
QNLRLLGQMRRLSPRFCLQDRKDFAFPQEVVEGSQLQEAQAFSVLHEMLQQTFNLFNTEH
SSAAWDTTLLEPLHTGLHQQLDDLDACLGQVMGEEDSALGRTGPTLAMKRYFXGIHVYLR
EKEYSDCAWEIVRLEIMRSLSSSTNLQERLRMMDGDQN
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacgccgtctcagccagcccagcagc
agcctcatmttccccatggccgtcatgctctctctactgatggccctggtgcttgtcagc
tacggcctgggaggatccctgggctgtgacctgtctcagaaccacatgctggttggcagg
cagaacctcaggctcctgggccaaatgaggagactctcccctcgcttctgtctgcaggac
agaaaagactttgctttcccccaggaggtggtggagggtagccagctccaggaggctcag
gccttctctgtgctccacgagatgctccagcagaccttcaaccttttcaacacagagcac
tcctctgctgcctgggacaccactctcctggagccgctccacactggactccatcagcag
ctggatgacctggatgcctgcctggggcaggtgatgggagaggaagactctgcgctggga
aggacgggccccacactggccatgaagaggtacttccamggaatccacgtctacctgaga
gagaaggaatatagtgactgcgcctgggaaatygtcagactggaaatcatgagatctttg
tcttcatcaaccaacttgcaagaaaggttaagaatgatggatggagaccagaattaa

KEGG   Bos indicus (zebu cattle): 109562637
Entry
109562637         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562637
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562637
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562637
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562637
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562637
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 109562637
NCBI-ProteinID: XP_019821225
UniProt: A0A6P5C6M0
LinkDB
Position
8
AA seq 195 aa
MAFXLSLLMALVLVSYGLGGSLGCDLSQNHMLVGRKNLRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAFSVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGLHQQLDDLD
TCLGPVTGEEDSALGRMGPTLAVKRYFQGIHVYLKEKEYSDCAWEIVRLEIMRALSSSTN
LQERLRMKDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcakgctctctctactgatggccctggtgctggtcagctacggcctgggagga
tcgctgggctgtgacctgtctcagaaccacatgctggttggaagaaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggtggccagctccaggaggcccaggccttctctgtgctc
cacgagatgctccagcagaccttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggacgacctggat
acctgcctgggcccggtgacgggagaggaagactctgcgctgggaaggatgggccccaca
ctggccgtgaagaggtacttccagggcatccatgtctacctgaaagagaaggaatacagc
gactgcgcctgggaaatcgtcagactggaaatcatgagagccttgtcttcatcaaccaac
ttgcaagaaaggttaagaatgaaggacggagacctgaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562638
Entry
109562638         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-G-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562638
   04151 PI3K-Akt signaling pathway
    109562638
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562638
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562638
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562638
   04621 NOD-like receptor signaling pathway
    109562638
   04622 RIG-I-like receptor signaling pathway
    109562638
   04623 Cytosolic DNA-sensing pathway
    109562638
   04650 Natural killer cell mediated cytotoxicity
    109562638
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562638
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562638
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562638
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562638
   05161 Hepatitis B
    109562638
   05160 Hepatitis C
    109562638
   05171 Coronavirus disease - COVID-19
    109562638
   05164 Influenza A
    109562638
   05162 Measles
    109562638
   05168 Herpes simplex virus 1 infection
    109562638
   05163 Human cytomegalovirus infection
    109562638
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562638
   05169 Epstein-Barr virus infection
    109562638
   05165 Human papillomavirus infection
    109562638
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562638
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562638
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562638
NCBI-ProteinID: XP_019821226
UniProt: A0A6P5C6H6
LinkDB
Position
8
AA seq 189 aa
MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAITWDESLLDKLRTALDQQLTDLQ
FCLRQEXGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaacgccatctgc
tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgcaacaactgaggagggtctccccttcttcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagarggctcggccatcacgtgg
gacgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa
ttctgtctgaggcaggaggmggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatatttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562640
Entry
109562640         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562640
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562640
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562640
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562640
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 109562640
NCBI-ProteinID: XP_019821227
UniProt: A0A6P5C801
LinkDB
Position
8
AA seq 220 aa
MASENLPQGSTRRCLSQPSSSLIFPMAFVLSLLMALVLVSYGPGGSLGCDLSPNHVLVGR
QNLKLLGQMRRLSPRFCLQERKDFAFPQEMVEVSQFQEAQAXXVLHEMLQQSFNLFHKER
SSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQ
EKGYSDCAWEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacgctgtctcagccagcccagcagc
agcctcatcttccccatggccttcgtgctctctctactgatggccctggtgctggtcagc
tatggcccgggaggatccctgggctgtgacttgtctccgaaccacgtgctggttggcagg
cagaacctcaagctcctgggccaaatgaggagactctcccctcgcttctgtctgcaggag
agaaaagactttgctttcccccaggagatggtggaggtcagccagttccaggaggcccag
gccnnnnntgtgctccatgagatgctccagcagagcttcaacctcttccacaaagagcgc
tcctctgctgcctgggacactaccctcctggagcagctcctcactggactccatcagcag
ctggatgacctggatgcctgcctgggcctgttgactggagaggaagactctgccctggga
aggacgggccccacactggccatgaagaggtacttccagggcatccatgtctacctgcaa
gagaagggatacagcgactgtgcctgggaaatcgtcagactggaaatcatgagatccttg
tcttcatcaaccagcttgcaagaaaggttaagaatgatggatggagacctgaaatcacct
tga

KEGG   Bos indicus (zebu cattle): 109562641
Entry
109562641         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562641
   04151 PI3K-Akt signaling pathway
    109562641
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562641
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562641
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562641
   04621 NOD-like receptor signaling pathway
    109562641
   04622 RIG-I-like receptor signaling pathway
    109562641
   04623 Cytosolic DNA-sensing pathway
    109562641
   04650 Natural killer cell mediated cytotoxicity
    109562641
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562641
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562641
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562641
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562641
   05161 Hepatitis B
    109562641
   05160 Hepatitis C
    109562641
   05171 Coronavirus disease - COVID-19
    109562641
   05164 Influenza A
    109562641
   05162 Measles
    109562641
   05168 Herpes simplex virus 1 infection
    109562641
   05163 Human cytomegalovirus infection
    109562641
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562641
   05169 Epstein-Barr virus infection
    109562641
   05165 Human papillomavirus infection
    109562641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562641
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562641
SSDB
Motif
Pfam: Interferon DUF2615
Other DBs
NCBI-GeneID: 109562641
NCBI-ProteinID: XP_019821228
UniProt: A0A6P5C6X9
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSLGCHLPHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTXGSAAAWDESLLDKLRTALDQQLTDLQ
ACLRQEEGLPGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccctcctcctggctctactgctgctcagctgcaacgccatctgc
tctctgggctgccacctgcctcactcccacagcctggccaagaggagagtcctgacactc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtactc
cacgaggtgacccaacacaccttccagcttttcagcacatagggctcggccgctgcgtgg
gatgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgccaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562642
Entry
109562642         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562642
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562642
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562642
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562642
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562642
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562642
NCBI-ProteinID: XP_019821229
UniProt: A0A6P5C6K5
LinkDB
Position
8
AA seq 185 aa
MACVLSLLMALLLVSYGPGGSLGCDLSQNHVLVGRQNLRLLGQMRRLSPRFCLQXRKDFA
FPQEMVEGSQLQEAQAFSVLHEMLQQSFNLFHTERSSVAWDTILLEQLRTGLHQQLDDLD
TCLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLKEKGYSDCAWEIXRXEIMRSLSSSTX
LQERL
NT seq 558 nt   +upstreamnt  +downstreamnt
atggcctgtgtgctctctctactgatggccctgttgctggtcagctatggcccaggagga
tctctgggctgtgacctgtctcaaaaccatgtgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggasagaaaagacttcgct
ttcccccaggagatggtggagggyagccagctccaggaggcccaggccttctctgtgctc
catgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgttgcctgg
gacaccatccttttggagcagctccgcactggactgcatcagcagctggacgacytggac
acctgcctggggcaagtgatgggagaggaagactctgccctgggaaggacgggccccaca
ctggccgtgaagaggtacttccagggcatccatgtctacctgaaagagaagggatacagc
gactgcgcctgggaaatyrtcagastggaaatcatgagatccttgtcttcatcaaccarc
ttgcaagaaaggttatga

KEGG   Bos indicus (zebu cattle): 109562643
Entry
109562643         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562643
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562643
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562643
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562643
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562643
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562643
NCBI-ProteinID: XP_019821231
UniProt: A0A6P5C6I1
LinkDB
Position
8
AA seq 220 aa
MASENLPQGSTRRRLSQPSSSLIFPMAFVLSLLMALVLVSYSSGRSLGCDLSQNHVLVGR
KNLRLLGQMKRLSPRFCLQDRKDFAFPQEMVEGSQLQEPQAISVLHEMLQQTFNLFHTER
SSAAWDTTLLEQLXTGLHQQLDDLDTCLGLVMGEKDXSLGRMGPTLAVKRYFQGIHVYLK
EKEYSDCAWEIVRVEIMRSFSSSTSLQERLXIMDGDLNSX
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacgccgtctcagccagcccagcagc
agcctcatcttccccatggccttcgtgctctctctactgatggccctggtgctggtcagc
tayagctcgggaagatccctgggctgtgacctgtctcaaaaccatgtgctggttggcagg
aagaacctcaggctcctgggccaaatgaagagactctcccctcgcttctgtctacaggac
agaaaagactttgctttccctcaggagatggtggagggcagccagctccargagccccag
gccatctctgtgctccacgagatgctccagcagaccttcaacctcttccacacagagcgc
tcctctgctgcctgggacaccaccctcctggagcagctcckcactggactccatcagcag
ctggaygacctggacacctgcctgggcctggtgatgggagagaaagactyttccctggga
aggatgggccccacactggccgtgaagaggtacttccagggcatccatgtctacctgaaa
gagaaggaatacagtgactgtgcctgggaaattgtcagagtggaaatcatgagatccttc
tcttcatcaaccagcttgcaagaaaggttaaraataatggatggagacctgaactcasct
tga

KEGG   Bos indicus (zebu cattle): 109562644
Entry
109562644         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-F
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562644
   04151 PI3K-Akt signaling pathway
    109562644
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562644
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562644
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562644
   04621 NOD-like receptor signaling pathway
    109562644
   04622 RIG-I-like receptor signaling pathway
    109562644
   04623 Cytosolic DNA-sensing pathway
    109562644
   04650 Natural killer cell mediated cytotoxicity
    109562644
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562644
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562644
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562644
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562644
   05161 Hepatitis B
    109562644
   05160 Hepatitis C
    109562644
   05171 Coronavirus disease - COVID-19
    109562644
   05164 Influenza A
    109562644
   05162 Measles
    109562644
   05168 Herpes simplex virus 1 infection
    109562644
   05163 Human cytomegalovirus infection
    109562644
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562644
   05169 Epstein-Barr virus infection
    109562644
   05165 Human papillomavirus infection
    109562644
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562644
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562644
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562644
NCBI-ProteinID: XP_019821232
UniProt: A0A6P5C805
LinkDB
Position
8
AA seq 228 aa
METMGSYLRHRPEGRSSENKESRFTESPTSPGEASARSPMAPAWSLLLALLLLSCNAICS
LGCHLPHIHSLANRRVLMLLQQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLH
EVTQHTSQLFSTEGLAAVWDESLLDKLRAALDQQLTDLQACLRQEEGLRGAPLLKKDSSL
AVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD
NT seq 687 nt   +upstreamnt  +downstreamnt
atggaaaccatgggctcctacttaagacacaggcctgaaggaaggtcttcagaraacaaa
gagagcaggttcacagagtcacccacctccccaggagaagcatctgcaaggtccccgatg
gccccagcctggtccttacttctggccctgctgctgctcagctgcaacgccatctgctct
ctgggttgccacctgcctcacatccacagcctggccaacaggagggtcctgatgctcctg
caacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgactttgcattc
ccccaggaggctctgggtggcagccagttgcagaaggctcaagccatctctgtgctccac
gaggtgacccagcacacctcccagctcttcagcacagagggcttggccgctgtgtgggat
gagagcctcctggacaagcttcgcgctgcactggatcagcagcttactgacctgcaagcc
tgtctgaggcaggaggaggggctgcgaggggcccccctgctcaagaaggactccagccta
gctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagccct
tgtgcctgggaagttgtcagagcagaagtcatgagagccttctcttcctcaacaaacttg
caggagagtttcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562645
Entry
109562645         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562645
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562645
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562645
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562645
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562645
NCBI-ProteinID: XP_019821233
UniProt: A0A6P5C6Y3
LinkDB
Position
8
AA seq 195 aa
MAVVLSLMMALVLVSYGPGGSLGCDLSQNHVLVGRKNLRLLGQMRRLSPRFCLQDRRDFA
FPQEMVEGGQLQEAQAISVLHEMLQQTFNLFHTERSSAAWDTTLLEQLLTGLHQQLDDLD
ACLGPVTGEEDSALGRTGPTLAVXRYFQGIHVYLKEKEYSDCAWEIVIVEIMRSFSSSIS
LQERLRMMDSDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccgttgtgctctctctaatgatggccctggtgctggtcagctatggccctggagga
tccctgggctgtgacctgtctcagaaccacgtgctcgttggcaggaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaagagacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
catgagatgctccagcagaccttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctcctcactggactccatcagcagctggacgacctggac
gcctgcttgggcccggtgacaggagaggaagactctgccctgggaaggacgggccccaca
ctggccgtgaakaggtacttccagggaatccatgtctacctgaaagagaaggaatacagc
gactgcgcctgggaaatcgtcatagtggaaatcatgagatcgttctcttcatcaatcagc
ttgcaagaaaggttaagaatgatggactcagatttgaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562646
Entry
109562646         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562646
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562646
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562646
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562646
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562646
SSDB
Motif
Pfam: Interferon CDT1_C DIRP
Other DBs
NCBI-GeneID: 109562646
NCBI-ProteinID: XP_019821234
UniProt: A0A6P5C6L3
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGLGGSLGCDLSPNHVLVGRKNLRLLGQMRRLSPRFCLQXRKDFA
FPQEMVKGGQLQEAQAISVLHEMLQQIFNLFHTERSSAAWDTTLLEQLCTGLHQQLDDLD
ACLGQVTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKEYSDCAWEIVRVEIMRSFSSXTS
LQERLRMKDGDPNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctattgatggccctggtgctggtcagctatggcctgggagga
tccctgggctgtgacctgtctccgaaccacgtgctcgttggcaggaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggasagaaaagacttcgct
ttcccccaggagatggtgaagggtggccagctccaggaggcccaggccatctctgtgctc
catgagatgctccagcagatcttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctttgcactggactccatcagcagctggacgacctggac
gcctgcctggggcaggtgacgggagaggaagactctgccctgggaaggacgggccccaca
ctggccatgaagaggtacttccagggaatccatgtctacctgcaagagaaggaatacagc
gactgtgcctgggaaatcgtcagagtggaaatcatgagatccttctcttcakcaaccagc
ttgcaagaaaggttaagaatgaaggatggagacccgaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562647
Entry
109562647         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562647
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562647
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562647
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562647
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 109562647
NCBI-ProteinID: XP_019821235
UniProt: A0A6P5C6M8
LinkDB
Position
8
AA seq 195 aa
MAFMLSLLMAVVLISYSLGGSLGCDLSPNHVLVGRKNLRLLGQMRRLSPRFCLQDRKDFT
FPQEMVKGGQLQEAQAISVLHELLQQTFNLFHTEHSSAAWDTTLLEQLHTGLHQQLDDLD
ACLGQVMGEEDSALGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWEIVRLEIMRSLSSSTS
LQERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcatgctctctctactgatggccgtggtgctgatcagctacagcctgggagga
tccctgggctgtgacctgtctccgaaccatgtgctggttggcaggaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcact
ttcccccaggagatggtgaagggtggccagctccaggaggcccaggccatctctgtgctc
cacgagctgctccagcagaccttcaacctcttccacacagagcattcctctgctgcctgg
gacaccaccctcctggagcagctccacactggactccatcagcagctggacgacctggac
gcctgcctggggcaagtgatgggagaggaagactctgccctgggaaggacaggccccaca
ctggccgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagt
gactgtgcctgggaaatcgtcagactggaaatcatgagatccttgtcttcatcaaccagc
ttgcaagaaaggttaagaatgatggatggagacctgaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562651
Entry
109562651         CDS       T04792                                 

Definition
(RefSeq) interferon tau-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562651
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562651
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562651
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562651
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562651
NCBI-ProteinID: XP_019821236
UniProt: A0A6P5C6I7
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYSPGRSLGCYLSENHMLGARENLRLLAQMNRLSTHSCLQDRKDFG
LPWEMVEGDQLQKDQAISVLHEMLQQCFNLFHTEHSSAAWNTTLLEQLCTGLHQQLDDLD
ACLGQVMEEKDSALGRMGPILTVKKYFQGIHVYLKKKEYSDCAWEIVRVEMIRALSSSTS
LQERLRKIGGDLNSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcttttgtgctctctctactgatggccttggtgctggtcagctacagcccgggacga
tctctgggttgttacctgtctgagaaccacatgctaggtgccagggagaacctcaggctc
ctggcccaaatgaacagactctccactcattcctgtctgcaagacagaaaagactttggt
cttccctgggagatggtggagggtgaccagctccagaaggaccaggctatctctgtgctc
cacgagatgctccagcagtgcttcaacctcttccacacagagcactcgtctgctgcctgg
aacaccaccctcctggagcagctctgcactggactccatcagcagctggatgacctggat
gcctgcctggggcaggtgatggaagagaaagactctgccctgggaaggatgggccccatt
ctgaccgtgaagaagtacttccagggcatccatgtgtacctgaaaaagaaggaatacagc
gactgcgcctgggaaatcgtcagagtggagatgataagagccctctcttcatcaaccagc
ttgcaagaaaggttaagaaagataggtggagatctgaactcatcttga

KEGG   Bos indicus (zebu cattle): 109562652
Entry
109562652         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-A
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562652
   04151 PI3K-Akt signaling pathway
    109562652
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562652
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562652
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562652
   04621 NOD-like receptor signaling pathway
    109562652
   04622 RIG-I-like receptor signaling pathway
    109562652
   04623 Cytosolic DNA-sensing pathway
    109562652
   04650 Natural killer cell mediated cytotoxicity
    109562652
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562652
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562652
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562652
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562652
   05161 Hepatitis B
    109562652
   05160 Hepatitis C
    109562652
   05171 Coronavirus disease - COVID-19
    109562652
   05164 Influenza A
    109562652
   05162 Measles
    109562652
   05168 Herpes simplex virus 1 infection
    109562652
   05163 Human cytomegalovirus infection
    109562652
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562652
   05169 Epstein-Barr virus infection
    109562652
   05165 Human papillomavirus infection
    109562652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562652
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562652
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562652
NCBI-ProteinID: XP_019821237
UniProt: A0A6P5C809
LinkDB
Position
8
AA seq 189 aa
MAPAWSFLLSLLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFE
FLQEALGGSQLQXXXEISVLHKVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQ
ACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctgctatccctgttgctgctcagctgcaacgccatctgc
tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgagacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgaa
ttcctccaggaggctctgggtggcagccagttacaannnnnnnnngaaatctctgtgctc
cataaggtgacccagcacaccttccagctcttcagcacagagggctcgcccgccacatgg
gacaagagcctcctggacaagctacgcgctgcgctggatcagcagctcactgacctgcaa
gcctgtctgacgcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562653
Entry
109562653         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562653
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562653
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562653
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562653
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562653
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 109562653
NCBI-ProteinID: XP_019821238
UniProt: A0A6P5C6Y7
LinkDB
Position
8
AA seq 195 aa
MAFRLSLLMALXLVSYNPGGSLGCDLSQNHVLVGRQNLXLLGQMRRLSPRFCLQERKDFA
FPQEMVEGGQLQEAQAFSVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGLHQQLDDLD
TCLGPVAEKEDSALGRTGPTLAVKRYFQGIHVYLQEKEYSDCAWEIVRLEIMRSFSSSTX
LQERLRMMDADLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcaggctstctctactgatggccctgntgctggtcagctacaacccaggagga
tccctgggctgtgatctgtctcagaaccatgtgctggttggcaggcagaacctcagkctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggaaagaaaagacttcgct
ttcccccaggagatggtggagggtggccagctccaggaggcccaggccttctctgtgctc
cacgagatgctccagcagaccttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggatgacctggac
acctgcctgggcccggtggcagaaaaggaagactctgctctgggaaggacaggccccaca
ctggccgtgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagt
gactgcgcctgggaaatcgtcagactggaaatcatgagatccttctcttcatcaaccasc
ttgcaagaaaggttaagaatgatggacgcagacctgaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562654
Entry
109562654         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562654
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562654
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562654
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562654
SSDB
Motif
Pfam: Interferon DUF4205 DIRP
Other DBs
NCBI-GeneID: 109562654
NCBI-ProteinID: XP_019821241
UniProt: A0A6P5C6J2
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSKNHVLVGRQNRRLLDQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLHEAQAISVLHEMLQQSFNLFHTERSSAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMGEEDSALGRMGPTLAMKRYFQGIHVYLKENQYSDCAWEIVRVEIMRSFSSSTN
LQERLRMMDGDLSSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtgacttgtctaagaaccacgtgctggttggcaggcagaaccgcaggctc
ctggaccaaatgaggagactctcccctcgcttctgtctacaggacagaaaagacttcgct
ttcccccaggagatggtggagggtggccagctccatgaggcccaggccatctctgttctc
cacgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctcgatgacctggac
gcctgcctggggcaagtgatgggagaggaagactctgccctgggaaggatgggccccaca
ctggccatgaagaggtatttccaaggcatccatgtctacctgaaagagaaccaatacagc
gattgtgcctgggaaatcgtcagagtggaaatcatgagatccttctcttcatcaaccaac
ttgcaagaaaggttaagaatgatggatggagacctgagctcaccttga

KEGG   Bos indicus (zebu cattle): 109562655
Entry
109562655         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562655
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562655
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562655
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562655
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562655
NCBI-ProteinID: XP_019821242
UniProt: A0A6P5C812
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYGSGGSLGCDLSQNHVLVGRQNLRLLDQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEPQAISVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMGEEDSALGRMGPTLAVKRYFHGIHVYLKEKEYSDCAWEIVRLEIMRSLSSSTS
LQERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacggctcgggagga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcaggcagaacctcaggctc
ctggaccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggaaatggtggagggcggccagctccaggagccccaggccatctctgtgctc
cacgagatgctccagcagaccttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggaacagctccgcactggactccatcagcagctggacgacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggatgggccccaca
ctggccgtgaagaggtacttccacggaatccatgtctacctgaaagagaaggaatacagc
gactgtgcctgggaaatcgtcagactagaaatcatgagatccttgtcttcatcaaccagc
ttgcaagaaaggttaagaatgatggatggagaccttaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562656
Entry
109562656         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562656
   04151 PI3K-Akt signaling pathway
    109562656
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562656
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562656
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562656
   04621 NOD-like receptor signaling pathway
    109562656
   04622 RIG-I-like receptor signaling pathway
    109562656
   04623 Cytosolic DNA-sensing pathway
    109562656
   04650 Natural killer cell mediated cytotoxicity
    109562656
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562656
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562656
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562656
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562656
   05161 Hepatitis B
    109562656
   05160 Hepatitis C
    109562656
   05171 Coronavirus disease - COVID-19
    109562656
   05164 Influenza A
    109562656
   05162 Measles
    109562656
   05168 Herpes simplex virus 1 infection
    109562656
   05163 Human cytomegalovirus infection
    109562656
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562656
   05169 Epstein-Barr virus infection
    109562656
   05165 Human papillomavirus infection
    109562656
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562656
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562656
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562656
NCBI-ProteinID: XP_019821243
UniProt: A0A6P5C6Z2
LinkDB
Position
8
AA seq 189 aa
MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFA
FPQEALHGSQLQKAQAISVLHEVTQHTFQLFSTEGSDATWDESLLDKLRTALDQQLTDLQ
ACLRQEEGLRGAPLLNEDSSLAVRKYFHRLTLYLQEKRHRPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaatgccatctgc
tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgcatggcagccagttgcagaaggctcaggccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctctgatgccacgtgg
gacgagagcctcctggacaagctccgcactgcactagatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaacgaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacaga
ccttgtgcctgggaggttgttagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562657
Entry
109562657         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562657
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562657
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562657
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562657
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562657
SSDB
Motif
Pfam: Interferon DUF4205 CDT1_C
Other DBs
NCBI-GeneID: 109562657
NCBI-ProteinID: XP_019821244
UniProt: A0A6P5C6M5
LinkDB
Position
8
AA seq 186 aa
MAFVLSLLMALVLVSYGLGGSLGCDLSPNHTLVGRKNLRLLDQMRRLSSCFCLQDRKDFA
FPQEMVEGGQLHEAQAISVLHEMLQQTFNLFHTERSSAAWYTTLLEQLHTGLHQQLDDLD
ACLGQVMGEEDSALGRRGPTLAVKRYFQGIHIYLQEKEYSDCTWEIVRVEMMRSFSSSAS
LRERLR
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacggcctgggagga
tccctgggctgtgacctgtctccgaaccacacgctggttggcaggaagaacctcaggctc
ctggaccaaatgaggagactctcctcttgcttctgtctccaggacagaaaagacttcgct
ttcccccaggagatggtggagggcggccagctccatgaggcccaggccatctctgtgctc
catgagatgctccagcagactttcaaccttttccacacagagcgctcctctgctgcctgg
tacaccaccctcctggagcagctccacactggactccatcagcagctggacgacctggac
gcctgcctggggcaggtgatgggagaggaagactctgccctgggaaggagaggccccaca
ctggccgtgaagaggtacttccagggcatccatatctacctgcaagagaaggaatacagc
gactgcacctgggaaattgtcagagtggagatgatgagatccttctcttcatcagccagc
ttgcgagaaaggttaagatga

KEGG   Bos indicus (zebu cattle): 109562658
Entry
109562658         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562658
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562658
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562658
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562658
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562658
NCBI-ProteinID: XP_019821245
UniProt: A0A6P5C6N7
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYSSGGSLGCDLSQNHVLVGRQNLRFLGQMRRLSPRFCLQDRKHFA
FPQEMVEGGQLQEAQAISVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGLHQQLDDLD
ACLGTVTGEEDSALGRTGPTLAVKRYFQGIHIYLKEKEYSDCAWEIVIVEIMRSLSSSTS
LQERLRMMDVDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacagctctggagga
tccctgggctgtgacctgtctcagaaccatgtgctggttggcaggcagaacctcaggttc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaacacttcgct
ttcccccaggagatggtggagggtggccagctccaggaggcccaggccatctctgttctc
cacgagatgctccagcagaccttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggaacagctccgcactggactccatcagcagctggacgacctggat
gcctgcctgggcacagtgacgggagaggaagactctgccctgggaaggacgggccccaca
ctggccgtgaagaggtacttccagggcatccatatctacctgaaagagaaggaatacagt
gactgtgcctgggaaatcgtcatagtggaaatcatgagatccttgtcttcatcaaccagc
ttgcaagaaaggttaagaatgatggatgtagacctgaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562659
Entry
109562659         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562659
   04151 PI3K-Akt signaling pathway
    109562659
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562659
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562659
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562659
   04621 NOD-like receptor signaling pathway
    109562659
   04622 RIG-I-like receptor signaling pathway
    109562659
   04623 Cytosolic DNA-sensing pathway
    109562659
   04650 Natural killer cell mediated cytotoxicity
    109562659
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562659
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562659
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562659
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562659
   05161 Hepatitis B
    109562659
   05160 Hepatitis C
    109562659
   05171 Coronavirus disease - COVID-19
    109562659
   05164 Influenza A
    109562659
   05162 Measles
    109562659
   05168 Herpes simplex virus 1 infection
    109562659
   05163 Human cytomegalovirus infection
    109562659
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562659
   05169 Epstein-Barr virus infection
    109562659
   05165 Human papillomavirus infection
    109562659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562659
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562659
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562659
NCBI-ProteinID: XP_019821246
UniProt: A0A6P5C6J7
LinkDB
Position
8
AA seq 198 aa
MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLTLLRQXRRVSPSSCLQDRNDFA
FPQEALHGSQLQKAQAISVLHEVTQHTFQLFSTEGSATTWDESLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDASLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTN
LQERFRRKDRHTPGSTQK
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaatgccatctgc
tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgacgctc
ctgcgacaamtgagaagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgcatggcagccagttgcagaaggctcaggccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccaccacgtgg
gacgagagcctcctggacaagctccgagctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggatgccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcttcctcaaccaac
ttgcaggagagattcaggagaaaggacagacacacacctggttcaacacagaaatga

KEGG   Bos indicus (zebu cattle): 109562660
Entry
109562660         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562660
   04151 PI3K-Akt signaling pathway
    109562660
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562660
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562660
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562660
   04621 NOD-like receptor signaling pathway
    109562660
   04622 RIG-I-like receptor signaling pathway
    109562660
   04623 Cytosolic DNA-sensing pathway
    109562660
   04650 Natural killer cell mediated cytotoxicity
    109562660
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562660
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562660
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562660
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562660
   05161 Hepatitis B
    109562660
   05160 Hepatitis C
    109562660
   05171 Coronavirus disease - COVID-19
    109562660
   05164 Influenza A
    109562660
   05162 Measles
    109562660
   05168 Herpes simplex virus 1 infection
    109562660
   05163 Human cytomegalovirus infection
    109562660
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562660
   05169 Epstein-Barr virus infection
    109562660
   05165 Human papillomavirus infection
    109562660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562660
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562660
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562660
NCBI-ProteinID: XP_019821247
UniProt: A0A6P5C817
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCIAICSLGCHLPHTHSLPNRRVLTLLRQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAVWDQSLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDASLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN
LQEKFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccctcctcctggccctgctgctgctcagctgcatcgccatctgc
tctttgggttgccacctgcctcacacccacagcctgcccaacaggagggtcctgacactc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgactttgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgctgtgtgg
gaccagagcctcctggacaagctccgagctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggatgccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcttcaacaaac
ttgcaggagaaattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562662
Entry
109562662         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562662
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562662
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562662
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562662
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562662
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 109562662
NCBI-ProteinID: XP_019821248
UniProt: A0A6P5C6Z7
LinkDB
Position
8
AA seq 220 aa
MASENLPQGSTRRCLSQASGHLIFPMAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLVGR
QNLRLLGQMRRLSPRFCLQERKHFAYPQEMVEGSQLQEAQAISVLHEMLQQTFNLFHTER
SSAAWDTTLLEQLRTGLHQQLDDLDACLGPVTGEEDSALGRMGPTLAVKRYFQGIHVYLK
EKEYSDCAWEIVIVEIMRSLSSSANLQERLRMMDGDLNSP
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacgctgcctcagccaggccagtggc
cacctcatcttccccatggccttcgtgctctctctactgatggccctggtgctggtcagc
tatggcccgggaggatccctgggctgtgacctgtctcagaaccacgtgctggttggcagg
cagaacctcaggctcctgggccaaatgaggagactctctcctcgcttctgtctgcaggaa
agaaaacacttcgcttacccccaggagatggtggagggcagccagctccaggaggcccag
gccatctctgtgctccacgagatgctccagcagaccttcaacctcttccacacagagcgc
tcctctgctgcctgggacaccaccctcctggagcagctccgcactggactccatcagcag
ctggatgacctggacgcctgcctgggcccggtgacaggagaggaagactctgccctggga
aggatgggccccacactggccgtgaagaggtacttccagggcatccatgtctacctgaaa
gagaaggaatacagtgactgcgcctgggaaatcgtcatagtggaaatcatgagatccttg
tcctcatcagccaacttgcaagaaaggttaagaatgatggatggagacctgaactcacct
tga

KEGG   Bos indicus (zebu cattle): 109562663
Entry
109562663         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562663
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562663
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562663
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562663
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562663
NCBI-ProteinID: XP_019821249
UniProt: A0A6P5C6N0
LinkDB
Position
8
AA seq 195 aa
MAFMLSLLMALVLVSYGPGGSLGCDLSQNHVLVGRQNLRLLDQMKRLSPRFCLQERKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGLHQQLDDLD
ACLGQVMEEEDSALGRTGPTLAVKRYFQGIHVYLKEKAYSDCAWEIVIVEIMRSLSSSIN
LQERLRMIDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcatgctctctctattgatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcaggcagaacctcaggctc
ctggaccaaatgaagagactctcccctcgcttctgtctgcaggaaagaaaagacttcgct
ttccctcaggagatggtggagggtgggcagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagaccttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggatgacctggac
gcctgcctggggcaggtgatggaagaggaagactctgccctgggaaggacgggccccaca
ctggccgtgaagaggtacttccagggaatccatgtctacctgaaagagaaggcatacagc
gactgcgcctgggaaatcgtcatagtggaaatcatgagatccttgtcttcatcaatcaac
ttgcaagaaaggttaagaatgatagatggagacctgaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562664
Entry
109562664         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562664
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562664
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562664
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562664
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 109562664
NCBI-ProteinID: XP_019821250
UniProt: A0A6P5C6P0
LinkDB
Position
8
AA seq 220 aa
MASENLPQGSTRRLPSQPSSSLIFPMAFRLSLLMALVLVSYGPGGSLGCDLSQNHMLVGR
KNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEGGQLQEAQAISVLHEMLQQTFNLFHTER
SSAAWDTTLLEQLHTGLHQQLDDLDACLGQVMGEEDSALGRMGPTLAMKRYFQGIHVYLK
EKEYSDCAWEIVRLEIMRALSSSTSLQERLRMMDGDLXSP
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcatcagagaacctacctcaaggttccaccagacgtcttcccagccagcccagcagc
agcctcatcttccccatggcctttaggctctctctactgatggccctggtgctggtcagc
tatggcccgggaggatccctgggctgtgacctgtctcagaaccacatgctggttggcagg
aagaaccttaggctcctgggccaaatgaggcggctctcccctcgcttttgtctgcaggac
agaaaagacttcgctttcccacaggagatggtggagggcggccagctccaggaggcccag
gccatctctgtgctccacgagatgctccagcagaccttcaacctcttccacacagagcgc
tcctctgctgcctgggacaccaccctcctggagcagctccacactggactccatcagcag
ctggatgacctggacgcctgcctggggcaggtgatgggagaggaagactctgccctggga
aggatgggccccacactggccatgaagaggtacttccagggcatccatgtctacctgaaa
gagaaggaatacagtgactgcgcctgggaaatcgtcagactggaaatcatgagagccttg
tcttcatcaaccagcttgcaagaaaggttaagaatgatggatggagacctgarctcacct
tga

KEGG   Bos indicus (zebu cattle): 109562665
Entry
109562665         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-B-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562665
   04151 PI3K-Akt signaling pathway
    109562665
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562665
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562665
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562665
   04621 NOD-like receptor signaling pathway
    109562665
   04622 RIG-I-like receptor signaling pathway
    109562665
   04623 Cytosolic DNA-sensing pathway
    109562665
   04650 Natural killer cell mediated cytotoxicity
    109562665
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562665
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562665
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562665
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562665
   05161 Hepatitis B
    109562665
   05160 Hepatitis C
    109562665
   05171 Coronavirus disease - COVID-19
    109562665
   05164 Influenza A
    109562665
   05162 Measles
    109562665
   05168 Herpes simplex virus 1 infection
    109562665
   05163 Human cytomegalovirus infection
    109562665
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562665
   05169 Epstein-Barr virus infection
    109562665
   05165 Human papillomavirus infection
    109562665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562665
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562665
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562665
NCBI-ProteinID: XP_019821252
UniProt: A0A6P5C821
LinkDB
Position
8
AA seq 189 aa
MAPAWSFLLSLLLLSCNAICSLGCHLPHSYSLPNRRVLMLLRQLRRVSPSSCLQDRNDFA
FPQEALGSSQLQKAQAISVLHEVTQHTFQLFSTEGSAATWDESLLDKLHAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRJTLYLREKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctgtccctgctgctgctcagctgcaatgccatctgc
tctctgggctgccacctgcctcactcctacagcctgcccaacaggagggtcctgatgctc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccacaggaggcgctgggtagcagccagttgcaaaaggctcaagccatctctgtgctc
cacgaggtgacccagcacacsttccagctcttcagcacagagggctcggctgccacgtgg
gacgagagcctcctggacaagctccacgctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggattccagc
ctggctgtgaggaaatacttccacagamtcactctctatctgcgagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562666
Entry
109562666         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562666
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562666
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562666
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562666
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562666
SSDB
Motif
Pfam: Interferon DIRP Syntaxin-6_N
Other DBs
NCBI-GeneID: 109562666
NCBI-ProteinID: XP_019821253
UniProt: A0A6P5C701
LinkDB
Position
8
AA seq 195 aa
MAFVLSLLMALVLVSYSPGGSLGCDLSQNHXLVGRQNLRLLGQMRRLSSRFCLQDRKDFA
FPQETVEGSQLQEAQAISVLHEMLQQSFNLFHTERSSAAWDTTLLEQLCTGLHQQLDDLD
ACLGQVMEEEDSALGRTGPTLAVKGYFQGIHVYLQEKEYSDCAWEIVRVEMMRALSSSTS
LQERLRKMGGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacagcccgggagga
tccctgggctgtgacctgtctcagaaccacrtgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactgtcctctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagacggtggagggcagccagctccaggaggcccaggccatctctgtgctc
catgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctgctggagcagctctgcactggactccatcagcagctggacgatctggat
gcctgcctggggcaggtgatggaagaggaagactctgccctgggaaggacgggccccaca
ctggctgtgaaggggtacttccagggaatccatgtctacctgcaagagaaggaatacagc
gactgcgcctgggaaatcgtcagagtggagatgatgagagccctctcgtcatcaaccagc
ttgcaagaaaggttaagaaagatgggtggagatctgaactcaccttga

KEGG   Bos indicus (zebu cattle): 109562667
Entry
109562667         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon beta-3-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562667
   04668 TNF signaling pathway
    109562667
   04151 PI3K-Akt signaling pathway
    109562667
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562667
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562667
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562667
   04621 NOD-like receptor signaling pathway
    109562667
   04622 RIG-I-like receptor signaling pathway
    109562667
   04623 Cytosolic DNA-sensing pathway
    109562667
   04650 Natural killer cell mediated cytotoxicity
    109562667
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562667
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562667
   05152 Tuberculosis
    109562667
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562667
   05161 Hepatitis B
    109562667
   05160 Hepatitis C
    109562667
   05171 Coronavirus disease - COVID-19
    109562667
   05164 Influenza A
    109562667
   05162 Measles
    109562667
   05168 Herpes simplex virus 1 infection
    109562667
   05163 Human cytomegalovirus infection
    109562667
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562667
   05169 Epstein-Barr virus infection
    109562667
   05165 Human papillomavirus infection
    109562667
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562667
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562667
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562667
NCBI-ProteinID: XP_019821254
UniProt: A0A6P5C6N5
LinkDB
Position
8
AA seq 186 aa
MTYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSAEVCQKLLGQLHSTPQHCLEARMDFQ
VPEEMNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLVELYGQMNRLQ
PIQKEIMQEQNFTMGDTTVLHLKKYYFNLVQYLESKEYNRCAWTVVRVQILTNFSFLMRL
TASLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgctccgattccagcaaaggcggagcgctgaggtgtgtcagaaa
ctcctggggcagttacattcaacgcctcaacattgcctcgaggccaggatggacttccag
gtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtcatc
tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg
tctgagaccatcattgaggacctccttgtggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcaggagcaaaacttcaccatgggggacacaaccgttctt
cacctgaagaagtattacttcaacctcgtgcagtacctggagtccaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgatgagacta
acagcttccctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562668
Entry
109562668         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562668
   04151 PI3K-Akt signaling pathway
    109562668
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562668
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562668
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562668
   04621 NOD-like receptor signaling pathway
    109562668
   04622 RIG-I-like receptor signaling pathway
    109562668
   04623 Cytosolic DNA-sensing pathway
    109562668
   04650 Natural killer cell mediated cytotoxicity
    109562668
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562668
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562668
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562668
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562668
   05161 Hepatitis B
    109562668
   05160 Hepatitis C
    109562668
   05171 Coronavirus disease - COVID-19
    109562668
   05164 Influenza A
    109562668
   05162 Measles
    109562668
   05168 Herpes simplex virus 1 infection
    109562668
   05163 Human cytomegalovirus infection
    109562668
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562668
   05169 Epstein-Barr virus infection
    109562668
   05165 Human papillomavirus infection
    109562668
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562668
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562668
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562668
NCBI-ProteinID: XP_019821255
UniProt: A0A6P5C6P5
LinkDB
Position
8
AA seq 186 aa
MTLPVSVLLALVMLCSSPMCSLGCELPASHHSNLESFTXWSQMERLPVVSCLRDRTDFRF
PQTLVXGTRLEKTEAIAVVHELLQQTFQLFSTTGSSAGRDESLLDRFLVGLDQQLEDLDT
CLREGRTPEQSPLGSENSRLAVKSYFQRISVYLKEKEYSRCAWEVLSVEIRRCLVFASKL
IGKLRK
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccctccctgtctctgtgctgctggccctggtgatgctctgctccagccccatgtgc
tccctgggctgtgagctgcctgcgagccaccacagcaatctggaaagcttcacacrttgg
agtcagatggagagactgcccgttgtgtcctgtctgagggacaggactgacttcagattt
cctcagaccctggtgcakgggaccaggcttgagaagacagaagccatagctgttgtacat
gagttgctccagcagaccttccagctcttcagcaccacaggctcttctgcaggtcgggac
gagagcctcctggacagattcctcgtgggacttgatcagcagctggaagacttggacacg
tgtctgagagagggaaggacaccrgaacagtcacctctagggagtgagaactccagattg
gctgtgaagagttacttccagcgaatcagtgtgtatctcaaagagaaagaatacagccgc
tgtgcctgggaggttctcagcgtggaaatcagaaggtgyttggtctttgccagcaagctc
atcggaaaactcaggaaataa

KEGG   Bos indicus (zebu cattle): 109562670
Entry
109562670         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562670
   04151 PI3K-Akt signaling pathway
    109562670
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562670
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562670
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562670
   04621 NOD-like receptor signaling pathway
    109562670
   04622 RIG-I-like receptor signaling pathway
    109562670
   04623 Cytosolic DNA-sensing pathway
    109562670
   04650 Natural killer cell mediated cytotoxicity
    109562670
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562670
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562670
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562670
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562670
   05161 Hepatitis B
    109562670
   05160 Hepatitis C
    109562670
   05171 Coronavirus disease - COVID-19
    109562670
   05164 Influenza A
    109562670
   05162 Measles
    109562670
   05168 Herpes simplex virus 1 infection
    109562670
   05163 Human cytomegalovirus infection
    109562670
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562670
   05169 Epstein-Barr virus infection
    109562670
   05165 Human papillomavirus infection
    109562670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562670
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562670
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562670
NCBI-ProteinID: XP_019821256
UniProt: A0A6P5C6K7
LinkDB
Position
8
AA seq 185 aa
MALLVXVLLALVMLCSSPTCSLGCELPSSHGNLESFTRWSQMERXPIVSCLRDRTDFRFP
QTLVHGTRLEETEATAVVHELLQQTFQLFSTTGSSAGRDKSLLDRFLVGLDQQLEDLDTC
LREGRTXEQSPLGSENSRLAVKSYFQRISVYLKEKEYSHCAWEVVSVEIRRCLVFANELI
GKLRK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggccctcctcgtcwctgtgctgctggccctggtgatgctctgctccagccccacgtgc
tccctgggctgtgagctgccttcgagccacggcaatctggaaagcttcacacgttggagt
cagatggagagastgcccattgtgtcctgtctgagggacaggactgacttcagatttcct
cagaccctggtgcatgggaccaggcttgaggagacagaagccacagctgttgtgcacgag
ttgctccagcagaccttccagctcttcagcaccacrggctcttctgcaggtcgggacaag
agcctcctggacagattcctcgtgggacttgatcagcagttggaggacctggacacgtgt
ctgagggagggaaggacacyggaacagtcacctctagggagtgagaactccagattggct
gtgaagagttacttccagcgaatcagtgtgtatctcaaagagaaagaatacagccactgt
gcctgggaggttgtcagtgtggaaatcagaaggtgcttggtctttgccaatgagctcatt
ggaaaactcaggaaataa

KEGG   Bos indicus (zebu cattle): 109562671
Entry
109562671         CDS       T04792                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562671
   04668 TNF signaling pathway
    109562671
   04151 PI3K-Akt signaling pathway
    109562671
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562671
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562671
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562671
   04621 NOD-like receptor signaling pathway
    109562671
   04622 RIG-I-like receptor signaling pathway
    109562671
   04623 Cytosolic DNA-sensing pathway
    109562671
   04650 Natural killer cell mediated cytotoxicity
    109562671
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562671
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562671
   05152 Tuberculosis
    109562671
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562671
   05161 Hepatitis B
    109562671
   05160 Hepatitis C
    109562671
   05171 Coronavirus disease - COVID-19
    109562671
   05164 Influenza A
    109562671
   05162 Measles
    109562671
   05168 Herpes simplex virus 1 infection
    109562671
   05163 Human cytomegalovirus infection
    109562671
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562671
   05169 Epstein-Barr virus infection
    109562671
   05165 Human papillomavirus infection
    109562671
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562671
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562671
SSDB
Motif
Pfam: Interferon DUF2154
Other DBs
NCBI-GeneID: 109562671
NCBI-ProteinID: XP_019821257
UniProt: A0A6P5C827
LinkDB
Position
8
AA seq 186 aa
MTHRCLLPMVLLLCFSTTALSRSYSLLQFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ
MPEEMKQEQQFRKEDAILVMYEMLQHIFGILTRDFSXTGWSETIIEDLLEELYGQINRLE
PIQKEIMQKQNFTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLMRL
TDYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccgttgcctcctcccaatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcaattccaacaaaggcggagccttgcagtgtgtcagaaa
ctcctgtggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagaacagcagttccggaaggaagatgccatattggtcatg
tatgagatgctccagcacatcttcggcattctcaccagagacttctccarcactggctgg
tctgagaccatcatygaggacctccttgaggaactctatgggcagataaatcgtctggag
ccaatccaaaaggaaataatgcagaagcaaaatttcactatgggagacacaactgttctt
cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg
tgtgcctggacagtygtgcgagtgcaaatactcaggaacttttctttcctgatgagacta
acagattacctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562673
Entry
109562673         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-3-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562673
   04151 PI3K-Akt signaling pathway
    109562673
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562673
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562673
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562673
   04621 NOD-like receptor signaling pathway
    109562673
   04622 RIG-I-like receptor signaling pathway
    109562673
   04623 Cytosolic DNA-sensing pathway
    109562673
   04650 Natural killer cell mediated cytotoxicity
    109562673
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562673
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562673
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562673
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562673
   05161 Hepatitis B
    109562673
   05160 Hepatitis C
    109562673
   05171 Coronavirus disease - COVID-19
    109562673
   05164 Influenza A
    109562673
   05162 Measles
    109562673
   05168 Herpes simplex virus 1 infection
    109562673
   05163 Human cytomegalovirus infection
    109562673
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562673
   05169 Epstein-Barr virus infection
    109562673
   05165 Human papillomavirus infection
    109562673
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562673
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562673
SSDB
Motif
Pfam: Interferon Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 109562673
NCBI-ProteinID: XP_019821258
UniProt: A0A6P5C708
LinkDB
Position
8
AA seq 157 aa
MQSCEPPASQWPSPSLCCWPLVMLCSSPTCSLGCELPSSHHGNLESFTCWSQMERLPIVS
CLRDRTDFRFPQTLVHGTRLEKTEATAAVHELLQQTFQLFSTTGSSAXRDESLLDRFLVG
LDQKLEDLDTCLREGRTREQSPLGXENSRXAVKXYFQ
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcagtcctgcgagcccccagcgtcccartggccctccccgtcactgtgctgctggccc
ttggtgatgctctgctccagccccacgtgctccctgggctgtgagctgccttcgagccac
cacggcaatctggaaagcttcacatgttggagtcagatggagagactgcccattgtgtcc
tgtctgagggacaggactgacttcagatttcctcagaccctggtgcacgggaccaggctt
gagaagacagaagccacagctgctgtgcacgagttgctccagcagaccttccagctcttc
agcaccacgggctcttctgcagrtcgggacgagagcctcctggacagattcctcgtggga
cttgatcagaagttggaggacctggacacgtgtctgagggagggaaggacacgggaacaa
tcacctctagggartgagaactccagatwggctgtgaagcrttacttccagtga

KEGG   Bos indicus (zebu cattle): 109562674
Entry
109562674         CDS       T04792                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562674
   04668 TNF signaling pathway
    109562674
   04151 PI3K-Akt signaling pathway
    109562674
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562674
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562674
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562674
   04621 NOD-like receptor signaling pathway
    109562674
   04622 RIG-I-like receptor signaling pathway
    109562674
   04623 Cytosolic DNA-sensing pathway
    109562674
   04650 Natural killer cell mediated cytotoxicity
    109562674
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562674
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562674
   05152 Tuberculosis
    109562674
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562674
   05161 Hepatitis B
    109562674
   05160 Hepatitis C
    109562674
   05171 Coronavirus disease - COVID-19
    109562674
   05164 Influenza A
    109562674
   05162 Measles
    109562674
   05168 Herpes simplex virus 1 infection
    109562674
   05163 Human cytomegalovirus infection
    109562674
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562674
   05169 Epstein-Barr virus infection
    109562674
   05165 Human papillomavirus infection
    109562674
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562674
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562674
SSDB
Motif
Pfam: Interferon SesA
Other DBs
NCBI-GeneID: 109562674
NCBI-ProteinID: XP_019821259
UniProt: A0A6P5C6P2
LinkDB
Position
8
AA seq 186 aa
MTHRCLLQMVLLLCFSTTALSRSYSLLRFQQRRSLAVCQKLLRQLPSTPQHCLEARMDFQ
MPEEMKQAQQFXKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLEELYEQMNRLE
PIQKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLTRL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcggtatgtcagaaa
ctcctgaggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagcacagcagttccrgaaggaagatgccatattggtcatc
tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg
tctgagaccatcatygaggacctccttgaggaactctatgagcagatgaatcgtctggag
ccaatccagaaggaaatcatgcagaagcaaaactccactatgggagacacgactgttctt
cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcaggaatttttctttcctgacgagacta
acaggttacctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562675
Entry
109562675         CDS       T04792                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562675
   04668 TNF signaling pathway
    109562675
   04151 PI3K-Akt signaling pathway
    109562675
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562675
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562675
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562675
   04621 NOD-like receptor signaling pathway
    109562675
   04622 RIG-I-like receptor signaling pathway
    109562675
   04623 Cytosolic DNA-sensing pathway
    109562675
   04650 Natural killer cell mediated cytotoxicity
    109562675
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562675
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562675
   05152 Tuberculosis
    109562675
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562675
   05161 Hepatitis B
    109562675
   05160 Hepatitis C
    109562675
   05171 Coronavirus disease - COVID-19
    109562675
   05164 Influenza A
    109562675
   05162 Measles
    109562675
   05168 Herpes simplex virus 1 infection
    109562675
   05163 Human cytomegalovirus infection
    109562675
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562675
   05169 Epstein-Barr virus infection
    109562675
   05165 Human papillomavirus infection
    109562675
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562675
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562675
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562675
NCBI-ProteinID: XP_019821260
UniProt: A0A6P5C6P9
LinkDB
Position
8
AA seq 186 aa
MTHRCLLQMVLLLCFSTTALSRSYSLLRFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ
MPEEMKQAQQFRKEDAILVIYEMLQQIFGILTRDFSSTGWSETIIEDLLEELYGQMNRLQ
PIQKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKXKEYNRCAWTVVRVQILRNFSFLTRL
TDXLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcagtgtgtcagaaa
ctcctgtggcagttaccgtcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccatattggtcatc
tatgagatgctccagcagatctttggcattctcaccagagacttctccagcactggctgg
tctgagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaatmatgcagaagcaaaactccactatgggagacacgactgttctt
cacctgaggaaatattacttcaacctcgtgcagtacctgaagtycaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcaggaatttttctttcctgacgagacta
acagattrcctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562827
Entry
109562827         CDS       T04792                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562827 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562827 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562827 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562827 (IFNK)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562827 (IFNK)
SSDB
Motif
Pfam: Interferon DUF3958
Other DBs
NCBI-GeneID: 109562827
NCBI-ProteinID: XP_019821420
UniProt: A0A6P5C782
LinkDB
Position
8
AA seq 259 aa
MQKLLLTKDTQVYKRHTKEYFRPKTSLSTSESCGFFTSMGEGKKMITKPDGIRKYVWLAC
LMGLFITGILSLDCNSLNVRLRRVTWQNLQLLSTMSNSFPIECLQERKAFELPQEILSYT
QPLQKNIKEAFYEMSKQAFHIFTQDTFQSTWEEKHLRQVQIGLDHQLQYLEQCLEEEEEE
NEDTREREELLSAGEETLRKPSGAPVLQLGNLDLRRYFNRIDRFLKDKKHSHCAWEIVRV
EIRRCFYFFQKLTALLRRR
NT seq 780 nt   +upstreamnt  +downstreamnt
atgcaaaaactcctcctcaccaaagatacccaggtgtataaaaggcacacaaaggaatac
ttcagacctaaaacctcattgtcaacctctgaatcttgtggatttttcacctccatgggy
gaggggaaaaaaatgatcaccaagcctgatgggattcgaaagtatgtgtggctggcgtgc
ctcatgggtctgtttatcactggcatcctctctctggactgtaactcgctgaatgttcgc
ctgaggagagtcacctggcagaatctrcaacttctgagcacaatgagcaattcatttcct
atagagtgtctacaagaaagaaaagctttcgagttgccccaagagatcctctcatacacc
cagcctctgcagaagaacatcaaggaggccttctatgaaatgtccaaacaggccttccac
atcttcactcaagacaccttccaatccacttgggaagagaaacacctgagacaagtccag
atcggacttgatcaccagctgcagtacctggagcaatgcttggaagaagaggaggaggaa
aatgaagacacaagagagagggaagagcttctctcagccggagaggagaccctcaggaaa
ccctcaggagctccggtcctccagctgggcaatctagatctgaggagatatttcaacagg
atagacaggttcctcaaagataagaaacacagtcactgcgcctgggagattgtccgagtg
gaaatcagaagatgcttctacttctttcagaaactcacagcattactcaggaggagataa

KEGG   Bos indicus (zebu cattle): 109562844
Entry
109562844         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562844
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562844
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562844
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562844
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562844
SSDB
Motif
Pfam: Interferon DALR_2 DIRP
Other DBs
NCBI-GeneID: 109562844
NCBI-ProteinID: XP_019821436
UniProt: A0A6P5C728
LinkDB
Position
8
AA seq 220 aa
MPSENLPQGSTRRLPSQPSSSLIFPMAFVLSLLMALVLVSYGPGRSLGCDLSQNHVLVGR
QNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEGGQLHEAQAISVLHEMLQQTFNLFHTER
SSAAWDTTLLEQLRTGLHQQLDNLDACLGLLTGKEDSALGRMGPTLAVKRYFQGIHVYLK
EKEYSDCAWEIIIMEIMRSFSSSTSLQERLRMMDGDLNSP
NT seq 663 nt   +upstreamnt  +downstreamnt
atgccatcagagaacctacctcaaggttccaccagacgccttcccagccagcccagcagc
agcctcatcttccccatggcctttgtgctctctctactgatggccctggtgctggtcagc
tatggcccgggaagatccctgggctgtgacctgtctcagaaccacgtgctggttggcagg
cagaacctcaggctcctgggccaaatgaggagactctcccctcgcttctgtctgcaggac
agaaaagacttcgctttcccccaggagatggtggagggcggccagctccacgaggcccag
gccatctctgtgctccatgagatgctccagcagaccttcaacctcttccacacagagcgc
tcctctgctgcctgggacaccactctcctggagcagctccgcactggactccatcagcag
ctggacaacctggatgcctgcctgggcctgttgacgggaaaggaagactctgccctggga
aggatgggccccacactggccgtgaagaggtacttccagggcatccatgtctacctgaaa
gagaaggaatacagcgactgtgcctgggaaatcatcataatggaaatcatgagatccttc
tcttcatcgaccagcttgcaagaaaggttaagaatgatggatggagacctgaactcacct
tga

KEGG   Bos indicus (zebu cattle): 109562846
Entry
109562846         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562846
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562846
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562846
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562846
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562846
SSDB
Motif
Pfam: Interferon DUF4205
Other DBs
NCBI-GeneID: 109562846
NCBI-ProteinID: XP_019821437
UniProt: A0A6P5C8I5
LinkDB
Position
8
AA seq 217 aa
MALLESMASENLPQGSTRRLPSQPSSSLIYPMAFVLSLLMALVLVSYGPGGSLGCDLSQN
HVLVGRENLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEGGQLHEAQAISVLHEILQQTFN
LFHTERSSAAWDTTLLEQLHTGLHQQLDDLDACLGQVMGEEDSALGRTGPTLAVKRYFQG
IHVYLKEKEYSDCAWEIVIMEIMRSLSSSTNLQERLR
NT seq 654 nt   +upstreamnt  +downstreamnt
atggccttgctagaaagcatggcatcagagaacctacctcaaggttccaccagacgcctt
cccagccagcccagcagcagcctcatctaccccatggccttcgtgctctctctactgatg
gccctggtgctggtcagctacggcccgggaggatccctgggctgtgacctgtctcagaac
catgtgctggttggcagggagaacctcaggctcctgggccaaatgaggagactctcccct
cgcttctgtctgcaggacagaaaagacttcgctttcccccaggagatggtggagggcggc
cagctccacgaggcccaggccatctctgtgctccatgagatactccagcagaccttcaac
ctcttccacacagagcgctcctctgctgcctgggacaccaccctcctggagcagctccac
actggactccatcagcagctggacgacctggacgcctgcctggggcaggtgatgggagag
gaagactctgccctgggaaggacgggccccacactggccgtgaagaggtatttccagggc
atccatgtctacctgaaagagaaggaatacagcgactgcgcctgggaaatcgtcataatg
gaaatcatgagatccttgtcttcatcaaccaacttgcaagaaaggytaagatga

KEGG   Bos indicus (zebu cattle): 109562847
Entry
109562847         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-H
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562847
   04151 PI3K-Akt signaling pathway
    109562847
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562847
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562847
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562847
   04621 NOD-like receptor signaling pathway
    109562847
   04622 RIG-I-like receptor signaling pathway
    109562847
   04623 Cytosolic DNA-sensing pathway
    109562847
   04650 Natural killer cell mediated cytotoxicity
    109562847
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562847
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562847
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562847
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562847
   05161 Hepatitis B
    109562847
   05160 Hepatitis C
    109562847
   05171 Coronavirus disease - COVID-19
    109562847
   05164 Influenza A
    109562847
   05162 Measles
    109562847
   05168 Herpes simplex virus 1 infection
    109562847
   05163 Human cytomegalovirus infection
    109562847
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562847
   05169 Epstein-Barr virus infection
    109562847
   05165 Human papillomavirus infection
    109562847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562847
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562847
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562847
NCBI-ProteinID: XP_019821438
UniProt: A0A6P5C7M6
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSXEGSAAVWDESLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLREKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc
tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcrcagagggctcagccgccgtgtgg
gatgagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctkcgagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcttcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562848
Entry
109562848         CDS       T04792                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04622  RIG-I-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562848
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562848
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    109562848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562848
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562848
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562848
NCBI-ProteinID: XP_019821439
UniProt: A0A6P5C788
LinkDB
Position
8
AA seq 171 aa
MAFVLSLLMALVLVSYSSGGSLGCDLSQNHVLVGRQNLRFLGQMRRLSPRFCLXXXXHFA
FPQEMVEGGQLQEAQAISVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGLHQQLDVLD
ACLGPVTGEEDSALGRMGPTLAMKRYFQGIHVYLKEKEYSDCAWEIVIVES
NT seq 516 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacagctctggagga
tccctgggctgtgacctgtctcagaaccatgtgctggttggcaggcagaacctcaggttc
ctgggccaaatgaggagactctcccctcgcttctgtctgcnnnnnnnnnaacacttcgct
ttcccccaggagatggtggagggcggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagaccttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggacgtcctcgac
gcctgcctgggcccggtgacaggagaggaagactctgccctgggaaggatgggccccaca
ctggccatgaagaggtacttccagggcatccatgtctacctgaaagagaaggaatacagt
gactgtgcctgggaaatcgtcatagtggaatcatga

KEGG   Bos indicus (zebu cattle): 109562852
Entry
109562852         CDS       T04792                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562852
   04668 TNF signaling pathway
    109562852
   04151 PI3K-Akt signaling pathway
    109562852
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562852
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562852
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562852
   04621 NOD-like receptor signaling pathway
    109562852
   04622 RIG-I-like receptor signaling pathway
    109562852
   04623 Cytosolic DNA-sensing pathway
    109562852
   04650 Natural killer cell mediated cytotoxicity
    109562852
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562852
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562852
   05152 Tuberculosis
    109562852
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562852
   05161 Hepatitis B
    109562852
   05160 Hepatitis C
    109562852
   05171 Coronavirus disease - COVID-19
    109562852
   05164 Influenza A
    109562852
   05162 Measles
    109562852
   05168 Herpes simplex virus 1 infection
    109562852
   05163 Human cytomegalovirus infection
    109562852
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562852
   05169 Epstein-Barr virus infection
    109562852
   05165 Human papillomavirus infection
    109562852
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562852
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562852
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562852
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562852
NCBI-ProteinID: XP_019821440
UniProt: A0A6P5C793
LinkDB
Position
8
AA seq 186 aa
MTHRCLLQMVLLLCFSTTALPRSYSLLGLQERRSAAVSQKLLRQLPSTPQRCLEARMDFQ
MPEEMKQAQQFQKEDAILVMYEMLQQIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLQ
PIQKEIMQKKNFTMGNTTVLHLKKYYLNLMYYLKSKEYNRCAWTVVRVQILTNFSFLKSL
TAYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
cccaggagctacagcttgcttggattgcaagaaaggcggagtgctgcggtctctcagaaa
ctcctgaggcagttaccttcaactcctcaacgttgcctcgaggccaggatggatttccag
atgcctgaggagatgaagcaagcacagcagttccagaaggaagatgccatattggtcatg
tatgagatgctccagcagatctttggcattcttaccagagatttctccagcactggctgg
tctgagaccatcatcgaggacctccttgtggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcagaagaaaaacttcactatgggaaacacaaccgttctt
cacctgaagaaatattacctcaacctcatgtactaccttaagtccaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgaagagccta
acagcttacctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562853
Entry
109562853         CDS       T04792                                 

Definition
(RefSeq) interferon beta-1-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562853
   04668 TNF signaling pathway
    109562853
   04151 PI3K-Akt signaling pathway
    109562853
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562853
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562853
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562853
   04621 NOD-like receptor signaling pathway
    109562853
   04622 RIG-I-like receptor signaling pathway
    109562853
   04623 Cytosolic DNA-sensing pathway
    109562853
   04650 Natural killer cell mediated cytotoxicity
    109562853
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562853
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562853
   05152 Tuberculosis
    109562853
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562853
   05161 Hepatitis B
    109562853
   05160 Hepatitis C
    109562853
   05171 Coronavirus disease - COVID-19
    109562853
   05164 Influenza A
    109562853
   05162 Measles
    109562853
   05168 Herpes simplex virus 1 infection
    109562853
   05163 Human cytomegalovirus infection
    109562853
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562853
   05169 Epstein-Barr virus infection
    109562853
   05165 Human papillomavirus infection
    109562853
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562853
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562853
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562853
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 109562853
NCBI-ProteinID: XP_019821441
UniProt: A0A6P5C730
LinkDB
Position
8
AA seq 186 aa
MTYQCLLQMVLLLCFSTTALSRSYSLLRFQQSQSLKECQKLLGQLPSTPQHCLEARMDFQ
MPEEMKQEQQFQKEDAILVMYEMLQHIFGILTRDFSSTGWSETIIEDLLEELYGQMNRLQ
PIQKEIMQKQNSTTGDTIVPHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNVSFLMRL
TGYVRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccagtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaagtcagagccttaaagagtgtcagaaa
ctcctggggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagaacagcagttccagaaggaagatgccatattggtcatg
tatgagatgctccagcacatcttcggcattctcaccagagacttctccagcactggctgg
tctgagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcagaagcaaaactccactacgggagacacgatcgttccc
cacctagggaaatattacttcaacctcatgcagtacctggagtccaaggagtacgacagg
tgtgcctggacagtcgtgcaagtgcaaatactcacgaacgtttctttcctgatgagacta
acaggttacgtccgtgactga

KEGG   Bos indicus (zebu cattle): 109562855
Entry
109562855         CDS       T04792                                 

Definition
(RefSeq) interferon beta-1
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562855
   04668 TNF signaling pathway
    109562855
   04151 PI3K-Akt signaling pathway
    109562855
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562855
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562855
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562855
   04621 NOD-like receptor signaling pathway
    109562855
   04622 RIG-I-like receptor signaling pathway
    109562855
   04623 Cytosolic DNA-sensing pathway
    109562855
   04650 Natural killer cell mediated cytotoxicity
    109562855
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562855
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562855
   05152 Tuberculosis
    109562855
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562855
   05161 Hepatitis B
    109562855
   05160 Hepatitis C
    109562855
   05171 Coronavirus disease - COVID-19
    109562855
   05164 Influenza A
    109562855
   05162 Measles
    109562855
   05168 Herpes simplex virus 1 infection
    109562855
   05163 Human cytomegalovirus infection
    109562855
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562855
   05169 Epstein-Barr virus infection
    109562855
   05165 Human papillomavirus infection
    109562855
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562855
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562855
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562855
NCBI-ProteinID: XP_019821442
UniProt: A0A6P5C8J0
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCFSTTALSRSYSLLRFQQSQSLKECQKLLGQLPSTPQHCLEARMDFQ
MPEEMKQEQQFQKEDAILVMYEVLQHIFGILTRDFSSTGWSETIIEDLLKELYWQMNRLQ
PIQKEIMQKQNSTTGDTIVPHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNXSFLMRL
TGYVRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccgrtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaagtcagagccttaaagagtgtcagaaa
ctcctggggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagaacagcagttccagaaggaagatgccatattggtcatg
tatgaggtgctccagcacatcttyggcattctcaccagagacttctccagcactggctgg
tctgagaccatcatcgaggacctccttaaggaactctattggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcagaagcaaaactccactacgggagacacgatcgttccc
cacctagggaaatattacttcaacctcatgcagtacctggagtccaaggagtacgacagg
tgtgcctggacagtcgtgcaagtgcaaatactcacgaacktttctttcctgatgagacta
acaggttacgtccgtgactga

KEGG   Bos indicus (zebu cattle): 109564477
Entry
109564477         CDS       T04792                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04620  Toll-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04940  Type I diabetes mellitus
biu05133  Pertussis
biu05134  Legionellosis
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05162  Measles
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
biu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109564477 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109564477 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109564477 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    109564477 (IL12A)
   04625 C-type lectin receptor signaling pathway
    109564477 (IL12A)
   04658 Th1 and Th2 cell differentiation
    109564477 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109564477 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109564477 (IL12A)
   05330 Allograft rejection
    109564477 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109564477 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109564477 (IL12A)
   05134 Legionellosis
    109564477 (IL12A)
   05152 Tuberculosis
    109564477 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109564477 (IL12A)
   05164 Influenza A
    109564477 (IL12A)
   05162 Measles
    109564477 (IL12A)
   05168 Herpes simplex virus 1 infection
    109564477 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109564477 (IL12A)
   05144 Malaria
    109564477 (IL12A)
   05145 Toxoplasmosis
    109564477 (IL12A)
   05140 Leishmaniasis
    109564477 (IL12A)
   05142 Chagas disease
    109564477 (IL12A)
   05143 African trypanosomiasis
    109564477 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109564477 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109564477 (IL12A)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109564477 (IL12A)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109564477 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 109564477
NCBI-ProteinID: XP_019823473
UniProt: A0A6P5CDG3
LinkDB
Position
1
AA seq 221 aa
MCPLRSLLLISTLVLLHHLPHLSLGRSLPTTTASPGRSCLDYSQNLLRAVSNTLQKARQT
LEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLASRETSFITNGHCLASGKTSF
MTTLCLRSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNFDSETVP
QKPSLKELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtgcccgcttcgcagcctcctcctcatatccaccctggttctcctccaccacctgccc
cacctcagtttgggcaggagcctccccaccaccacagcaagcccaggaaggagctgcctc
gactactcccaaaacctgctgagggctgtcagcaacacgctacagaaggccagacaaacc
ctagaattttactcctgcacttctgaggagatcgatcatgaagatatcaccaaagataaa
accagcacagtggaggcctgtttaccactggaattagccacgaatgagagttgcctggct
tccagagagacctcttttataactaatgggcattgtctggcttctggaaagacctctttt
atgacaaccctgtgccttagaagtatctatgaggacttgaagatgtaccacgtggagttc
caggccatgaatgcaaagcttctgatggatcctaagaggcaaatctttctagaccagaac
atgctggcagctattgctgagctgatgcaggccctgaatttcgacagtgagactgtgcca
cagaaaccctccctgaaagaactggatttttacaagacaaaagtcaagctctgcatcctt
cttcacgccttcagaattcgtgcggtgaccatcgacagaatgatgagctatctgagttct
tcctag

KEGG   Bos indicus (zebu cattle): 109567051
Entry
109567051         CDS       T04792                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04657  IL-17 signaling pathway
biu04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109567051 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109567051 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109567051 (IL17D)
   04659 Th17 cell differentiation
    109567051 (IL17D)
   04657 IL-17 signaling pathway
    109567051 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109567051 (IL17D)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109567051 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 109567051
NCBI-ProteinID: XP_019827368
UniProt: A0A6P5CPF0
LinkDB
Position
12
AA seq 195 aa
MGGVWALVAGVLLALSPGRAGGAPKAGRRPARARGCADRPEELLEQLYGRLAAGVLGAFH
HTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPGRFPRYLPEAYCL
CRGCLTGPRGEEDVRLRSAPVLVPAVVLRRTPGCAGGRAVYVEEYVTVPVGCTCVPGPDK
DADAANSSLDKSARP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggggcgtctgggcgttggtggccggtgtcctgctggcgctgtcgccgggccgggcg
gggggcgccccgaaggcgggccggcggccagcacgggcgcggggctgcgcggaccggccc
gaggagctcctggagcagctgtacgggcgactggcggccggcgtgctcggcgccttccac
cacacgctgcagctgggcccgcgcgagcaggcgcgcaacgccagctgcccggccgggggc
aggcccgccgaccgccgcttccggccgcccaccaacctgcgcagcgtgtcgccctgggcc
tacaggatctcctacgacccgggccgcttcccgcggtacctgcccgaggcctactgcctg
tgccggggctgcctgaccgggccacgcggggaggaggacgtgcgcctgcgcagcgcccca
gtgctcgtgcctgcggtggtcctgcgccgcaccccgggctgcgcaggcggtcgcgccgtc
tacgtcgaggagtatgtcactgtgcccgtgggctgcacctgcgtgcccgggccggacaag
gatgcggacgccgccaactccagcctggacaagtcggcccggccctga

KEGG   Bos indicus (zebu cattle): 109568650
Entry
109568650         CDS       T04792                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7
  KO
K05431  interleukin 7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109568650 (IL7)
   04151 PI3K-Akt signaling pathway
    109568650 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109568650 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109568650 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568650 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109568650 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109568650 (IL7)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109568650 (IL7)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109568650 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 109568650
NCBI-ProteinID: XP_019829628
UniProt: A0A6P5CVH0
LinkDB
Position
14
AA seq 176 aa
MFHVSFRYIFGIPPLILVLLPVASSDCDISGKDGGAYQNVLMVNIDDLDNMINFDSNCLN
NEPNFFKKHSCDDNKEASFLNRASRKLRQFLKMNISDDFKLHLSTVSQGTLTLLNCTSKG
KGRKPPSLSEAQPTKNLEENKSSKEQKKQNDLCFLKILLQKIKTCWNKILRGIKEH
NT seq 531 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattagcggtaaagacggtggagcatatcagaatgtt
ctaatggtcaacatcgatgacttggacaacatgataaactttgatagcaattgcctgaat
aacgaacctaacttttttaaaaaacattcatgtgatgataataaggaagcttcatttttg
aatcgtgcttctcgaaagttgaggcaattccttaaaatgaatatcagtgacgatttcaag
cttcacctatcaacagtttcacagggcacattaacactgctgaactgcaccagcaagggt
aaaggaagaaaaccaccttccctgagtgaagctcaacccactaagaatttggaagagaat
aaatcttcaaaggaacagaaaaaacagaatgacctgtgtttcctaaagatactactacaa
aagataaaaacttgttggaataaaattttgaggggcattaaagaacactga

KEGG   Bos indicus (zebu cattle): 109570102
Entry
109570102         CDS       T04792                                 

Gene name
IL20
Definition
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109570102 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570102 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109570102 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109570102 (IL20)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109570102 (IL20)
SSDB
Motif
Pfam: IL10 IL22 DUF3587 MitMem_reg DUF4119
Other DBs
NCBI-GeneID: 109570102
NCBI-ProteinID: XP_019831463
UniProt: A0A6P5D0A0
LinkDB
Position
16
AA seq 176 aa
MRGSGLPLCLLSAVFYLFWTPSAGLKTLHLGSCVITTNLQGIRSGFSEIRDSVQAKDEII
DVRILRKTQSLQGTKPADQCCLLHHILRLYLDRVFKNYQPPDHHIFRKVSRLANSLLTIK
KDLRLCHAHMSCPCGEEAKEKYSQILSHFEELPPQAVVVKALGELDILLQWMEEAD
NT seq 531 nt   +upstreamnt  +downstreamnt
atgagaggttctggtcttcccctctgccttctttctgctgtgttttatctcttctggaca
ccttctgctgggctgaaaacactgcatttgggaagctgtgtgatcaccacaaatcttcag
ggaattcgaagtggattttcagagattcgggacagtgtgcaagccaaagatgaaatcatt
gacgtcagaatcttgaggaagactcagtctttgcaaggcacaaagcctgcagatcagtgc
tgcctcctccatcatatactgagactttacctggacagggtattcaaaaactatcaaccc
cctgaccaccatatcttccggaaggtcagccgtcttgccaactctcttctcaccatcaag
aaggacctccggctgtgtcatgcccatatgtcatgcccttgtggggaagaagcaaaggag
aaatacagccagattctgagtcacttcgaagagcttccgcctcaggcagtggtggtgaag
gctttgggggagctagacattctcttgcaatggatggaagaggcagactag

KEGG   Bos indicus (zebu cattle): 109570104
Entry
109570104         CDS       T04792                                 

Gene name
IL24
Definition
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109570104 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570104 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109570104 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109570104 (IL24)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109570104 (IL24)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 109570104
NCBI-ProteinID: XP_019831465
UniProt: A0A6P5D0P2
LinkDB
Position
16
AA seq 237 aa
MVCVCGRLPNFLPLRXEPATTNQQALKHPFQGPRMLTHRGAPFPQQDPPGPSLLQMNSSM
HVAALPCLSLMLLLWSPGPWVRGQEFQFGPCRVEGVVLQKLWQAFWAMKDIVQAQDNIMS
VRLLRKEVLQNVSETESCHLIHALLRFYVNTVFKNYHDKAVEFGILKPFSTLANNFFVIV
SKLQASQEKMFSTRKSARRRFLLFYQAFKQLDREAAVTKAFGEMDILLSWMEKFYQL
NT seq 714 nt   +upstreamnt  +downstreamnt
atggtgtgtgtgtgtggacgcctgcccaactttcttcctctacgacrggaaccagccacc
accaaccagcaagccctcaagcatcccttccagggcccgaggatgctcactcacaggggt
gctcccttcccccagcaggatcctcctggaccttctttgctgcagatgaactcttctatg
cacgtggctgctcttccctgcttgagtctgatgctgcttctctggagcccggggccttgg
gtccggggccaagagttccagtttgggccctgccgggtagaaggagtagttctccagaaa
ctgtggcaggccttctgggccatgaaggacattgtgcaagctcaagataacatcatgagt
gtccggctgctgcggaaagaggttctgcagaacgtctcggagactgagagctgccacctc
atccatgccctgctgaggttctacgtgaacactgtcttcaaaaactaccatgacaaggct
gttgaattcgggatcctgaagccattctctactctggccaacaacttctttgtcatcgtg
tcaaaactgcaagccagtcaggaaaagatgttttccacccgtaagagtgcacgcaggcga
tttttgctgttctaccaagcatttaaacagttggacagagaagcagctgtgaccaaagcc
tttggagaaatggacattctcttgagctggatggagaaattctaccagctctga

KEGG   Bos indicus (zebu cattle): 109570244
Entry
109570244         CDS       T04792                                 

Gene name
IL19
Definition
(RefSeq) interleukin-19
  KO
K05444  interleukin 19
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109570244 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570244 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109570244 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109570244 (IL19)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109570244 (IL19)
SSDB
Motif
Pfam: IL10 DUF1664
Other DBs
NCBI-GeneID: 109570244
NCBI-ProteinID: XP_019831571
UniProt: A0A6P5CZW5
LinkDB
Position
16
AA seq 177 aa
MKAPCXSLXLLGAGLFLCSVHARGLRRCLISMNLHRVEESFXGIKTAIQAKDTFQNVTIL
SPSETLHGIKPLDVCCVTKNLLAFYVDRVFKDHQELNPQIMRKISSLANSFLYMQKTLQQ
CQNLCHCRQEATNATRIIHDNYDQLEVRSAAVKSLGELDVFLAWIDKHHRGTSAASR
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaggcaccgtgcrtttccctcygcctcctgggtgccgggctcttcctgtgctcagtg
catgcccgaggcctcaggagatgcctgatttccatgaacttgcaccgygtggaggagagc
ttccraggaatcaaaacagccattcaagctaaggacaccttccaaaacgtcaccatcctg
tccccatcggagaccctgcatggcattaagcccttagatgtgtgctgcgtgaccaagaac
ctcctggcattttatgtggacagagtgttcaaggaccatcaggagctgaacccccaaatc
atgagaaaaatcagcagccttgccaactctttcctctacatgcagaagactctacaacaa
tgtcagaatctgtgtcactgcagacaggaagcaaccaatgcaaccagaatcatccatgac
aactatgatcagctggaggtccggtctgctgctgttaagtctctgggagagctggacgtc
tttctagcctggattgacaagcatcatcgaggaacttccgctgcctcaagataa

KEGG   Bos indicus (zebu cattle): 109570808
Entry
109570808         CDS       T04792                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04068  FoxO signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04660  T cell receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109570808 (IL10)
   04068 FoxO signaling pathway
    109570808 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570808 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109570808 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109570808 (IL10)
   04660 T cell receptor signaling pathway
    109570808 (IL10)
   04672 Intestinal immune network for IgA production
    109570808 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109570808 (IL10)
   05322 Systemic lupus erythematosus
    109570808 (IL10)
   05320 Autoimmune thyroid disease
    109570808 (IL10)
   05321 Inflammatory bowel disease
    109570808 (IL10)
   05330 Allograft rejection
    109570808 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109570808 (IL10)
   05133 Pertussis
    109570808 (IL10)
   05150 Staphylococcus aureus infection
    109570808 (IL10)
   05152 Tuberculosis
    109570808 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109570808 (IL10)
   05144 Malaria
    109570808 (IL10)
   05145 Toxoplasmosis
    109570808 (IL10)
   05140 Leishmaniasis
    109570808 (IL10)
   05142 Chagas disease
    109570808 (IL10)
   05143 African trypanosomiasis
    109570808 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109570808 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109570808 (IL10)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109570808 (IL10)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109570808 (IL10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 109570808
NCBI-ProteinID: XP_019832543
UniProt: A0A6P5D353
LinkDB
Position
16
AA seq 179 aa
MPSSSALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRAAFGXVKTFFQMKD
QLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPXAENHGPDIKEHVNSLGEKLKTL
RLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcccagcagctcagccctgctctgttgcctggtcttcctggctggggtggcagccagy
cgagatgcgagcaccctgtctgacagcagctgtatccacttgccaaccagcctgccccac
atgctgcgggagctccgagctgccttcggcarggtgaagactttctttcaaatgaaggac
caactgcacagcttactgttgacccagtctctgctggatgactttaagggttacctgggt
tgccaagccttgtcggaaatgatccagttttacctggaagaggtgatgccamaggctgag
aaccacgggcctgacatcaaggagcacgtgaactcactgggggagaagctgaagaccctc
cggctgcggctgcggcgctgtcatcgctttctgccctgcgaaaacaagagcaaggcggtg
gagaaggtgaagagagtcttcagtgagctccaagagaggggtgtctacaaagccatgagt
gagtttgacatcttcatcaactacatagaaacctacatgacaacgaagatgcaaaagtga

KEGG   Bos indicus (zebu cattle): 109570838
Entry
109570838         CDS       T04792                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M
  KO
K05418  oncostatin M
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109570838 (OSM)
   04151 PI3K-Akt signaling pathway
    109570838 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570838 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109570838 (OSM)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109570838 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 109570838
NCBI-ProteinID: XP_019832551
UniProt: A0A6P5D2R9
LinkDB
Position
17
AA seq 237 aa
MRAQRMQRTLLSLVLRLLLLCSVATGKCSGKYHELLLQLQRQADLMQDPSTLLDPYIRLQ
GLHSPXLQEHCRERPGDFPSEDALWRLSRQDFLQTLNTTLGLILRMLSALQQDLPEAAHQ
QAEMNVRGFGNNIHCMAQLLRGSSDPKAAEPTQPGPGPTPLPPTPPSSTFQRKLRNCGFL
RGYHRFMRTAGQVLRGWGERQGRSRRHSPCRALKRGARRTRPFPEIRRLAPRGQPPR
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcgggcacagcgtatgcagagaacactgctcagtctggtcctcagacttctgctcctg
tgctcagtggccacgggcaagtgctcgggcaagtaccacgagcttctcctgcarctycag
cgccaggcggacctcatgcaggaccccagcacgctcctggatccctacatccgcctccaa
ggcctacacagtcccrtactgcaggaacactgcagggagcgcccgggggactttcccagc
gaggatgccctgtggaggctcagcaggcaggacttcctgcagaccctcaacaccacactg
ggcctcatccttcgcatgctgagtgccctgcagcaggacctcccggaagcagcccaccaa
caggcggagatgaatgtccgcgggttcgggaacaacatccactgcatggcccagctgctg
cgtggctcctcggacccaaaggctgctgagcccacccagccgggcccagggcccaccccg
ctgccacccacgccgccttccagyaccttccagcgcaagctcaggaactgtgggttcctg
cgaggctaccaccgcttcatgcgcacagccgggcaggtcctccggggctggggggagaga
cagggccgcagccgcagacacagcccctgccgggccctgaagaggggggcccgcaggaca
cggcccttcccggagatcaggagactcgcgcccaggggccagccgccccggtag

KEGG   Bos indicus (zebu cattle): 109571028
Entry
109571028         CDS       T04792                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04151  PI3K-Akt signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05135  Yersinia infection
biu05142  Chagas disease
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
biu05321  Inflammatory bowel disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109571028 (IL2)
   04151 PI3K-Akt signaling pathway
    109571028 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109571028 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109571028 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109571028 (IL2)
   04660 T cell receptor signaling pathway
    109571028 (IL2)
   04658 Th1 and Th2 cell differentiation
    109571028 (IL2)
   04659 Th17 cell differentiation
    109571028 (IL2)
   04672 Intestinal immune network for IgA production
    109571028 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109571028 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109571028 (IL2)
   05321 Inflammatory bowel disease
    109571028 (IL2)
   05330 Allograft rejection
    109571028 (IL2)
   05332 Graft-versus-host disease
    109571028 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109571028 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109571028 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109571028 (IL2)
   05171 Coronavirus disease - COVID-19
    109571028 (IL2)
   05162 Measles
    109571028 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109571028 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109571028 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109571028 (IL2)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109571028 (IL2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109571028 (IL2)
SSDB
Motif
Pfam: IL2 DUF922
Other DBs
NCBI-GeneID: 109571028
NCBI-ProteinID: XP_019832709
UniProt: Q8HZ67
LinkDB
Position
17
AA seq 145 aa
MYKIQLLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH
TFDFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQG
SETRFTCEYDDATVNAVEFLNKWIT
NT seq 436 nt   +upstreamnt  +downstreamnt
atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcgttgcaaacggt
gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat
ttacagttgcttttggagaaagttaaaaatcctgagaacctcaagctctccaggatgcat
acatttgacttttacgtgcccaaggttaacgctacagaattgaaacatcttaagtgttta
ctagaagaactcaaacttctagaggaagtgctaaatttagctccaagcaaaaacctgaac
cccagagagatcaaggattcaatggacaatatyaagagaatcgttttggaactacaggga
tctgaaacaagattcacatgtgaatatgatgatgcaacagtaaacgctgtagaatttctg
aacaaatggattacct

KEGG   Bos indicus (zebu cattle): 109571034
Entry
109571034         CDS       T04792                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21 isoform X1
  KO
K05434  interleukin 21
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109571034 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109571034 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109571034 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    109571034 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109571034 (IL21)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109571034 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 109571034
NCBI-ProteinID: XP_019832713
UniProt: A0A6P5D3M2
LinkDB
Position
17
AA seq 164 aa
MRSTPGNMERIVICLMVIFSGTVAHKSSSQGQDRLFIRLRQLIDIVDQLKNYVNDLDPEF
LPAPEDVKRHCERSAFSCFQKVQLKSANNGDNEKIINILTKQLKRKLPATNAGRRQKHEV
TCPSCDSYEKKPPKEYLERLKSLIQKVYNKLHLIFYFILTQMAS
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagatccactcctggcaacatggagagaatagtcatttgcctgatggtcatcttctct
gggacagtggcccataagtcaagctcccaagggcaagatcgcctctttattagactgcgt
caacttatagacattgttgatcagctgaaaaactatgtgaatgacttggatcctgaattt
ctgccagctccagaagatgtaaagagacactgtgagcggtcagctttttcatgttttcag
aaggttcaactaaagtcagcaaataatggagacaacgaaaagataatcaacatattaact
aaacagctgaagaggaaactacctgccacaaatgcagggagaagacagaaacatgaagta
acatgtccttcttgtgattcttatgagaaaaaaccacccaaggaatacctagaaagactg
aaatcactcatccaaaaggtatataacaaattacatttgattttctatttcatccttacc
cagatggcgtcttaa

KEGG   Bos indicus (zebu cattle): 109571474
Entry
109571474         CDS       T04792                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15
  KO
K05433  interleukin 15
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04668  TNF signaling pathway
biu04672  Intestinal immune network for IgA production
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109571474 (IL15)
   04668 TNF signaling pathway
    109571474 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109571474 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    109571474 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109571474 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109571474 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109571474 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109571474 (IL15)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109571474 (IL15)
SSDB
Motif
Pfam: IL15 AKAP28
Other DBs
NCBI-GeneID: 109571474
NCBI-ProteinID: XP_019833535
UniProt: A0A6P5D727
LinkDB
Position
17
AA seq 162 aa
MRILKPYLRSTSIQCYLCLLLNSHFLTEAGIHVFILGCISASLPKTEANWQYVINDLKTI
EHLIQSIHMDATLYTESDAHPNCKVTAMQCFLLELRVILHESKNATIYEIIENLTMLANS
NLSSIENKTELGCKECEELEEKSIKEFLKSFVHIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaattttgaaaccatatttgagaagtacttccatccagtgctacttgtgtttactt
ctgaacagtcattttttaacagaggctggcattcatgtcttcattttgggctgtatcagt
gcaagtcttcccaaaacagaagcaaactggcagtatgtaataaatgatttgaaaacaatt
gagcatcttattcaatctatacatatggatgccactttatatactgaaagtgatgctcat
cccaattgcaaagtaacagcgatgcagtgctttctcctggagttacgagttattttacac
gagtccaaaaatgccaccatttatgaaataatagaaaatcttaccatgctagcaaacagc
aatttatcttctattgagaataaaacagaattgggatgcaaagaatgtgaggaactggag
gaaaaaagtatcaaagaatttttgaagagttttgtacatattgtgcaaatgttcatcaac
acttcttga

KEGG   Bos indicus (zebu cattle): 109571543
Entry
109571543         CDS       T04792                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04630  JAK-STAT signaling pathway
biu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109571543 (LIF)
   04668 TNF signaling pathway
    109571543 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109571543 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109571543 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109571543 (LIF)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109571543 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 109571543
NCBI-ProteinID: XP_019833640
UniProt: A0A6P5D7B8
LinkDB
Position
17
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCATRHPCPSNLMNQIRNQLGQLNSSAN
SLFILYYTAQGEPFPNNLDKLCSPNVTDFPPFHANGTEKARLVELYRIIAYLGASLGNIT
RDQKVLNPYAHGLHSKLSTTADVLRGLLSNVLCRLCSKYHVSHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQVIAVLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccttgctgctggttctccactggaaacacggg
gccgggagcccccttcccatcaccccggtcaacgccacctgtgccacccgccatccctgt
cccagcaacctcatgaaccagatcagaaaccagctgggacaactcaacagcagtgccaac
agcctctttatcctctattacacggcccagggggagcccttccccaacaacctggacaag
ctgtgcagccccaacgtgactgacttcccgcccttccacgccaacggcacagagaaggcc
cggctggtggagctgtaccgcatcatcgcgtacctgggcgcctccctgggcaacatcacg
agagaccagaaggtcctcaacccctacgcccacggcctgcacagcaagctgagcaccacg
gccgacgtcctgcggggtctgctcagcaacgtgctctgccgcttgtgcagcaagtaccac
gtgagccacgtggacgtgacctacggccccgacacctcgggcaaggacgtcttccagaag
aagaagctgggctgtcagctcctggggaagtacaagcaggtcatcgccgtgctggcccag
gccttctag

KEGG   Bos indicus (zebu cattle): 109578719
Entry
109578719         CDS       T04792                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578719 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109578719 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109578719 (CTF1)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109578719 (CTF1)
SSDB
Other DBs
NCBI-GeneID: 109578719
NCBI-ProteinID: XP_019843741
UniProt: A0A6P5DZL9
LinkDB
Position
25
AA seq 202 aa
MSRREGSLEDPQADSSASPLPHLEAKIQQTHSLARLLTKYAEQLLQEYVQHQGDPFGLPG
FSPPRLPVADLSDPAPGHAGLPVPERLRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAAVAASTASAGVFPAKVLGFRVCG
LYLEWVSRTEADLGQLAPGGPA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgagccggagggagggcagtctggaggacccccaggctgactcctcagcctcacccctt
ccccacttggaggccaagatccaacagacacacagccttgcccgcctcctcaccaaatat
gctgagcagcttctccaggaatatgtgcagcaccagggagaccccttcgggctgcccggc
ttctcgcccccgcggctgccggtggccgatctgagcgacccggccccgggccacgctggc
ctgccagtgcccgagcgcctgcggctggacgnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnggacgccgcagtcgcc
gcctccactgcctcagcgggcgtcttcccggccaaggtgctggggttccgtgtgtgcggc
ctctacctcgagtgggtgagccgcactgaggccgacctgggccagctggcgcccgggggc
ccggcctga

DBGET integrated database retrieval system