KEGG   Bos indicus (zebu cattle): 109558203
Entry
109558203         CDS       T04792                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6 isoform X1
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05212  Pancreatic cancer
biu05214  Glioma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109558203 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109558203 (CDK6)
   04115 p53 signaling pathway
    109558203 (CDK6)
   04218 Cellular senescence
    109558203 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558203 (CDK6)
   05206 MicroRNAs in cancer
    109558203 (CDK6)
   05203 Viral carcinogenesis
    109558203 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109558203 (CDK6)
   05225 Hepatocellular carcinoma
    109558203 (CDK6)
   05214 Glioma
    109558203 (CDK6)
   05220 Chronic myeloid leukemia
    109558203 (CDK6)
   05218 Melanoma
    109558203 (CDK6)
   05224 Breast cancer
    109558203 (CDK6)
   05222 Small cell lung cancer
    109558203 (CDK6)
   05223 Non-small cell lung cancer
    109558203 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109558203 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109558203 (CDK6)
   05164 Influenza A
    109558203 (CDK6)
   05162 Measles
    109558203 (CDK6)
   05163 Human cytomegalovirus infection
    109558203 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109558203 (CDK6)
   05169 Epstein-Barr virus infection
    109558203 (CDK6)
   05165 Human papillomavirus infection
    109558203 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109558203 (CDK6)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109558203 (CDK6)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109558203 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 109558203
NCBI-ProteinID: XP_019815232
UniProt: A0A6P5BLM2
LinkDB
Position
4
AA seq 376 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDCCCRQCY
YLCGEWGCGRRAVSCRARHDVWPDCSALEACVLLVWLLWQLPFAWLSSRSLVLLCCLLGV
FSDASTIRGRGAQWPGNPSLFTGLHVPIEHPVISQVGFALFGFVFLGKGWSATQLTSLWN
TEKGNENPRFHPSVCG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgtgccgaccagcagtatgagtgcgtggcggagatcggg
gagggcgcctacgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgagtgcagactggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gacgtgtgtacagtgtcacgaacagacagagaaaccaaactaacgttagtgtttgaacac
gttgatcaagacttgaccacttatttggataaagtgccagaacctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggcctggactttcttcattctcaccga
gtggtgcatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaag
ctggctgacttcggccttgctcgcatctacagttttcagatggctcttacctcagtggtc
gtcacgctgtggtaccgagctccggaagtcctgcttcagtccagctacgccacccctgtg
gatctctggagcgttggctgcatmtttgcagagatgtttcgtagaaagccgctttttcgt
ggaagttcagatgtcgaccaactaggaaaaatcttggactgctgctgcagacagtgttac
tatttgtgtggtgagtggggatgtggtagacgtgccgtttcgtgcagagcccgtcacgac
gtgtggcctgactgctctgccctggaagcctgtgtgttgctcgtgtggctcctttggcag
ctcccctttgcttggctgagctcccgttctttagttctgttgtgttgtctgcttggggtc
ttttcagatgcttccaccatcagagggcggggtgctcagtggcctggtaacccatcctta
ttcactgggcttcatgtccccattgaacatcctgtaatcagccaggttggctttgcattg
tttggttttgtgttcctgggcaaaggatggtctgctactcaattgacttctctttggaac
actgaaaaaggaaatgagaatcctaggttccatccctctgtctgtggctaa

KEGG   Bos indicus (zebu cattle): 109559308
Entry
109559308         CDS       T04792                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04530  Tight junction
biu04660  T cell receptor signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05212  Pancreatic cancer
biu05214  Glioma
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109559308 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109559308 (CDK4)
   04115 p53 signaling pathway
    109559308 (CDK4)
   04218 Cellular senescence
    109559308 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109559308 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109559308 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559308 (CDK4)
   05203 Viral carcinogenesis
    109559308 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109559308 (CDK4)
   05225 Hepatocellular carcinoma
    109559308 (CDK4)
   05214 Glioma
    109559308 (CDK4)
   05220 Chronic myeloid leukemia
    109559308 (CDK4)
   05218 Melanoma
    109559308 (CDK4)
   05219 Bladder cancer
    109559308 (CDK4)
   05224 Breast cancer
    109559308 (CDK4)
   05222 Small cell lung cancer
    109559308 (CDK4)
   05223 Non-small cell lung cancer
    109559308 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109559308 (CDK4)
   04934 Cushing syndrome
    109559308 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559308 (CDK4)
   05160 Hepatitis C
    109559308 (CDK4)
   05164 Influenza A
    109559308 (CDK4)
   05162 Measles
    109559308 (CDK4)
   05163 Human cytomegalovirus infection
    109559308 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559308 (CDK4)
   05169 Epstein-Barr virus infection
    109559308 (CDK4)
   05165 Human papillomavirus infection
    109559308 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109559308 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109559308 (CDK4)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109559308 (CDK4)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109559308 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 109559308
NCBI-ProteinID: XP_019816493
UniProt: A0A6P5BTD8
LinkDB
Position
5
AA seq 303 aa
MATSXYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
DAE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctccygatatgagccagtggctgagattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg
cggcgtctggaggcttttgagcatcccaatgttgtcaggcttatggacgtctgtgcaaca
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagatctc
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccataaaagatctg
atgcgccaatttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat
cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgattggactgcccccagaggatgactggccccga
gatgtctctctaccccgaggagccttttccccccgagggccccgcccagtgcagtcggtg
gtccctgagctggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt
gacgcagagtga

DBGET integrated database retrieval system