KEGG   Bos indicus (zebu cattle): 109558333
Entry
109558333         CDS       T04792                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04072  Phospholipase D signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04640  Hematopoietic cell lineage
biu04916  Melanogenesis
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109558333 (KITLG)
   04014 Ras signaling pathway
    109558333 (KITLG)
   04015 Rap1 signaling pathway
    109558333 (KITLG)
   04072 Phospholipase D signaling pathway
    109558333 (KITLG)
   04151 PI3K-Akt signaling pathway
    109558333 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109558333 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    109558333 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558333 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109558333 (KITLG)
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109558333 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 109558333
NCBI-ProteinID: XP_019815342
LinkDB
Position
5
AA seq 257 aa
MNLHVLKISTDFIKQGVHSQCILETVFENLVVTVLKTGALSSFNFLQPSHCWISEMVEQL
SVSLTDLLDKFSNISEGLSNYCIIDKLVKIVDDLVECMEEHSSENVKKSSKSPEPRQFTP
EKFFGIFNKSIDAFKDLEIVASKMSECVISSTSSPEKDSRVSVTKPFMLPPVAASSLRND
SSSSNRKASNSIEDSSLQWAAVALPAFFSLVIGFAFGAFYWKKKQPNLTRTVENRQINEE
DNEISMLQEKEREFQEV
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaacttgcatgtgcttaagataagcactgattttataaaacaaggagttcattctcag
tgtattttggaaacagtctttgagaacttggttgtgactgtacttaaaacaggtgctttg
tcttcttttaatttcttacagcctagtcattgttggataagcgagatggtggaacaactg
tcagtcagcttgactgatcttctggacaagttttcgaatatttctgaaggcttgagtaat
tattgtatcatagacaaacttgtgaaaatagttgatgaccttgtggagtgcatggaagaa
cactcatctgagaatgtaaaaaaatcatctaagagcccagaacccaggcagtttactcct
gagaaattttttggaatttttaataaatccatcgatgccttcaaggacttggagatagtg
gcttctaaaatgagtgaatgtgtgatttcctcaacatcaagtcctgaaaaagattccaga
gtcagtgtcacaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgac
agcagtagcagtaataggaaggcctcaaattccattgaagattccagcctacaatgggca
gccgtagcattgccagcattcttttctcttgtgatcgggtttgcttttggggccttttac
tggaagaagaaacaaccaaatcttacaaggacagttgaaaacagacagattaatgaagag
gataatgaaataagtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system