KEGG   Bos indicus (zebu cattle): 109558343
Entry
109558343         CDS       T04792                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04640  Hematopoietic cell lineage
biu04810  Regulation of actin cytoskeleton
biu05100  Bacterial invasion of epithelial cells
biu05133  Pertussis
biu05135  Yersinia infection
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109558343 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109558343 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109558343 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109558343 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109558343 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109558343 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109558343 (ITGA5)
   05205 Proteoglycans in cancer
    109558343 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109558343 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109558343 (ITGA5)
   05414 Dilated cardiomyopathy
    109558343 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109558343 (ITGA5)
   05133 Pertussis
    109558343 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    109558343 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109558343 (ITGA5)
   05165 Human papillomavirus infection
    109558343 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109558343 (ITGA5)
   04515 Cell adhesion molecules [BR:biu04515]
    109558343 (ITGA5)
   04090 CD molecules [BR:biu04090]
    109558343 (ITGA5)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109558343 (ITGA5)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109558343 (ITGA5)
CD molecules [BR:biu04090]
 Proteins
  109558343 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 109558343
NCBI-ProteinID: XP_019815348
UniProt: A0A6P5BAL7
LinkDB
Position
5
AA seq 1097 aa
MPEVQRTHGKDLGLFMKSKEEDMLALVPSLTPVNKCSLLGLSFSLQGRQAGDSGSLLRRG
ARRRPRLLPLLPPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGTDGV
SVLVGAPKANTSQPGVLQGGAVYLCPWGTSPAQCTPIEFDSKGSRIFESSTSSSEGEEPV
EYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPQSDPVGTCYLSTGNFTQILEYAPCRS
DFSQEAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPGYLINPV
RGQLQTRQASSIYDDSYLGYSVAVGEFSGDDREDFVAGVPKGNLTYGYVTILNGSDIRSL
YNFSGEQMASYFGYAVAATDINGDGLDDLLVGXXXXXXRTADGRPQEVGRVYIYLQRLAG
MEPTPTLTLTGQDEFGRFGSSLTPLGDLDQDGYNDVAIGAAFGGENRQGVVFIFPGGPGG
LASKPSQVLLPLWAAGHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRPIVS
ASASLTIFPAMFNPEEHSCSLEGNPVTCINLSFCLNASGKHVPDSIGFTVELQLDWQKQK
GGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDP
QAPVDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNSL
NLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLG
NPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVSL
NGVSKPEAVLFPMSDWHPQDQPQEEGDVGPAVHHVYELINLGPSSISQGVLELSCPHALD
GQQLLYVTRVTGLSNCTTSHPPNPEGLELDPEGSQHHRLQRRDVPGRSPASSGPQILKCP
EAECFKLRCELGPLHRQESRSLQLHFRVWAKTFLQREHQPFSLQCEAVYEALKMPYKILP
RQLPQKALQVATAVQWIKAEGSHGVPLWIIILAILIGLLLLGLLIYILYKLGFFKRSLPY
GTAMEKAQLKPPATSDA
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgccagaagtccagagaactcatgggaaggacttgggccttttcatgaaaagcaaggag
gaggacatgctggccctcgtccccagcctgacaccagtcaataaatgcagtctcctgggt
ctaagcttcagccttcagggcaggcaggctggtgacagcgggagtctgctacgccggggc
gcccggcgcagaccccggctgctgccgttgttgccgccgctgctgctgctgctgctgccg
ccgccgccccgggtcgggggcttcaatttagacgcggaggccccggcagtgctctccggg
cccccgggctccttcttcggcttctcggtggagttttaccggccggggacggacggggtc
agcgtgctggtgggggcgcccaaggctaacaccagccagccgggagtgctgcagggcggt
gccgtctacctctgcccctggggcaccagcccggcacagtgcacccccattgaatttgac
agcaaaggctctcggatcttcgagtcctcaacgtccagctcagagggagaggagcctgtg
gagtacaagtccctgcagtggtttggagcaacagtgcgagcccatggctcctccatcctg
gcctgtgctcccctctacagctggcgcaccgagaaggagccgcagagtgatcctgtgggc
acctgctacctctccacaggcaacttcacccagattctggagtatgcaccctgccgctca
gatttcagccaagaagcaggacagggttactgccaagggggcttcagtgctgagttcacc
aagacggggcgtgtggtcctgggtggaccagggagctatttctggcaaggccagatcctg
tccgccacccaggagcagattgcagaatcctattatcccgggtacctgatcaacccagtt
cgggggcagctgcagactcgccaggccagttccatctacgatgacagctacctgggatac
tctgtggctgtgggtgaattcagtggtgatgatagagaagacttcgttgctggtgtgccc
aaagggaacctcacctacggctatgtcaccatccttaatggctcagacatccggtccctc
tacaacttttcaggggaacagatggcctcctactttggctacgcagtggccgccacagac
atcaacggggatgggctggacgacttgctggtaggggnnnnnnnnnnnnnnnagcggaca
gccgacgggcggccgcaggaggtgggcagggtctatatctacctgcagcgcctggctggc
atggagcccacgcccaccctgaccctcactggccaggatgagtttggccggttcggcagc
tccctgacccccctgggggacctagaccaggatggctacaatgatgtagccattggggct
gcctttggtggggagaaccggcagggagtggtgtttatattccctgggggcccagggggt
ctggcgtctaagccttcccaggttctgctgcccctgtgggcagctggccacacaccggac
ttctttggctctgcccttcgaggaggccgagacctagatggcaatggataccctgatctg
attgtggggtcctttggtgtagacaaggctgtggtatacaggggtcgccccatcgtgtct
gccagtgcctccctcaccatctttcctgccatgttcaacccagaggagcacagctgcagc
ttggagggaaaccctgtgacttgcatcaaccttagcttctgcctcaatgcttccggaaaa
catgttcctgactccattggcttcacggtggagctccagttggactggcagaagcagaag
ggcggggtgcggcgggcgctgttcctggcctcccgacaggccaccctgacccagaccctg
ctcatccagaacggggctcgggaggactgcagagagatgaagatctacctcaggaacgag
tcagagtttcgagataaactctccccgattcacatcgccctcaatttctccctggaccct
caagccccagtggacagccacggcctccggccagtcctacactaccagagcaagagccgc
atagaggacaaggctcagatcttgctggactgtggagaagacaatatctgtgtgccagac
ctacagctggaagtgtttggggagcagaaccacgtatacctgggcgacaagaattctctg
aacctcaccttccacgcccagaatgtgggtgagggtggcgcctacgaggcagagcttcgg
gtcacagcccctccggaggctgagtactcgggactcgtcagacacccagggaacttctcc
agcctgagctgcgactactttgctgtgaaccagagtcgtctgctggtgtgtgacctgggc
aaccccatgaaggctggggccagtctctggggtggccttcggttcacagtccctcacctc
agggacacgaagaaaaccatccagtttgacttccagatcctcagcaagaatctcaacaac
tcgcaaagcgacgtggtttccttccggctctcggtggaggctcaggcccaggtctctctt
aacggtgtctccaagcccgaggcagtgctatttccgatgagcgactggcatccccaagac
cagccgcaggaggagggtgacgtgggccctgctgtccaccatgtctatgagctcatcaac
ctgggccccagctctattagccagggcgtgttggagctcagctgtccccatgctctggat
ggccagcagctcctctacgtgaccagggtcacaggactcagcaactgcaccaccagtcac
ccccccaacccagagggcctggagttggatcctgagggttcccagcaccaccggctgcaa
agacgggatgttccaggtcggagccctgcctcctcagggcctcagattctgaaatgccca
gaggcagagtgtttcaagctgcgctgtgagctggggccactgcaccggcaagagagccga
agtctgcaactgcatttccgcgtctgggccaagaccttcctacagcgggagcaccagcca
tttagcctgcagtgtgaagccgtgtatgaagccctgaagatgccctataaaatcctgcct
cggcagcttccccagaaggcgctgcaggtggccacagctgtgcagtggatcaaggcagaa
ggcagccacggagtccctctctggatcattatcttagccatcctcattggcctcctgctc
ctcggtctgctcatctatatcctctacaagctcggattcttcaaacgctccctcccgtac
ggcaccgccatggaaaaagctcagctcaagcctccagccacctccgatgcctga

KEGG   Bos indicus (zebu cattle): 109565881
Entry
109565881         CDS       T04792                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4 isoform X1
  KO
K06483  integrin alpha 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04640  Hematopoietic cell lineage
biu04670  Leukocyte transendothelial migration
biu04672  Intestinal immune network for IgA production
biu04810  Regulation of actin cytoskeleton
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05165  Human papillomavirus infection
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109565881 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109565881 (ITGA4)
   04514 Cell adhesion molecules
    109565881 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109565881 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109565881 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109565881 (ITGA4)
   04670 Leukocyte transendothelial migration
    109565881 (ITGA4)
   04672 Intestinal immune network for IgA production
    109565881 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109565881 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109565881 (ITGA4)
   05414 Dilated cardiomyopathy
    109565881 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109565881 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109565881 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109565881 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109565881 (ITGA4)
   04515 Cell adhesion molecules [BR:biu04515]
    109565881 (ITGA4)
   04090 CD molecules [BR:biu04090]
    109565881 (ITGA4)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109565881 (ITGA4)
  Exosomal proteins of other cancer cells
   109565881 (ITGA4)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109565881 (ITGA4)
CD molecules [BR:biu04090]
 Proteins
  109565881 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 109565881
NCBI-ProteinID: XP_019825406
UniProt: A0A6P5CHG7
LinkDB
Position
2
AA seq 1033 aa
MAVEARRGPGPRGAAVWEAVMFLLCSGVPTGRPYNVDTESALLYKGPPNTLFGYSVVLHS
HGANRWLVVGAPTANWLSNTSVVKPGAIYRCKVGKNPARTCEQLQLGSPFGDPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIRTESKLPTGVCYGMPSDLRTELSKRI
APCYQDYVKQFGENFASCQAGISSFYTEDLIVMGAPGSYYWTGSLFVYNMTTNKYKAFID
KYNQVKFGSYLGYSVGAGHFRSXRSTEVVGGAPQHEQIGKAYIFSIDAKELNILHEMKGK
KLGSYFGASICAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAAMNEMETELIG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRVDGISTTFSQRIEG
RQISNSLSMFGQSISGQIDADNNGYLDVAVGAFRSDSAVLLRTRPVVIVEASLNHPESVN
RTNFDCIENGLPSVCMDLTLCFSYKGKKVPDYMVLLYNMSLDVNRKTESPSRFYFSSNGT
YDVITRSIKVQSKATSCKTHQAFMRKDVRDILTPIQIEATYHLGHHVISKRSIEEFPPLQ
PILQQKKEKDIIEKTINFARFCAHENCTADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLYNAGDDAYETTLHIKLPTGLYFIKILDLEEKQINCEVTDSSGIVRLDCRVGYIYVDH
LSKTDVSFLLDASSLSRADEDLNITVHAACENEGETGDVKRNKVTVTIPLKYEVMLTVHG
FVSPASFMYGPKEEDXFEMCTTEKMNFTFHVINTGQSMAPNIGVEIMIPNSFSPRTDKLF
NILDVQTTAGECHFKNYQRKCALDQKKGTMETLKDIFRFLSKTDKRLLYCMKADPYCLNI
SCHFGKMDSGKEASVHIQLEGRPSILEMDETKALKFEIRATAFPEPNPKVIELKKDENVA
HVLLEGLHHQRPRRHFTIMIISSSLLLGLILLFFISYVMWKAGFFKRQYQSILQKENRRD
SWSYINSKSDKDD
NT seq 3102 nt   +upstreamnt  +downstreamnt
atggctgtggaagcgaggcgagggccgggcccccgaggggccgccgtctgggaggcggtg
atgtttctgttgtgctcgggagtcccgaccgggcgcccctacaacgtggacacggagagc
gcgctgctctacaagggaccccccaacaccctgttcggctactcggtggtgctgcacagc
cacggggcgaaccgatggctcgtagtcggggcgcccactgccaactggctctccaacact
tcagtggtcaaacctggggctatttacagatgcaaggttgggaagaatccagccaggacc
tgcgaacagctccagctaggtagcccttttggagatccttgtggaaagacttgcttggaa
gaaagagataatcaatggctgggggtcacgctttccagacagcctggagaaaacggctcc
attgtgacttgtgggcatagatggaaaaatatattttacataaggactgagtctaagctc
cccacgggtgtctgctatggaatgccttctgatttacgaacagaactgagtaaaagaata
gctccatgctatcaagattatgtgaaacaatttggagagaattttgcatcatgtcaagct
ggaatatctagtttttacacagaggatttaattgtgatgggagctccaggatcatactat
tggactggctctctttttgtgtacaatatgactacaaataaatacaaggctttcatagac
aaatacaaccaagtaaaatttggaagttatttaggatactcagttggagcyggtcatttt
cggagtcygcgcagtactgaggtagttggaggagcccctcaacatgaacagattggtaaa
gcatacatattcagcattgatgcaaaagaactaaatatcttacatgaaatgaaaggtaaa
aagcttgggtcttattttggagcatctatctgtgccgtggacctcaaygcagatggcttc
tcagacctactcgtgggagctcccatgcagagcaccatcagggaagaaggaagagtgttt
gtgtacatcaactctggttccggagcagcaatgaacgaaatggaaacagagctcattgga
agtgacaaatacgctgcaagattcggggaatctatagtcaatcttggcgacattgataat
gatggctttgaagatgttgctattggagccccacaggaagatgacttgcaaggtgctatt
tatatttacaatggccgagtagatgggatctcaacaaccttctcacagagaattgaagga
cgtcaaatcagtaactcattaagtatgtttggacagtctatatctggacaaattgatgca
gataacaatggatatctagatgtagcagttggtgcttttcggtctgattctgctgtgttg
ctaaggacaagacctgtagtgattgtcgaagcttctttaaaccatcccgagtcagtaaat
aggacaaattttgactgtattgaaaatggattgccctctgtgtgcatggatctgacactc
tgtttctcatataagggcaaaaaggttccagattatatggttttgctttataacatgagc
ctggatgtgaaccgaaagacagagtctccatcgagattttacttttcttccaatggaact
tatgatgtgattacaagaagcattaaagtacagagcaaagcaactagctgcaaaacacat
caagcatttatgcggaaagatgtacgggacatcctcaccccaatccagattgaagccact
taccacctggggcatcatgtcatcagtaaacgaagtatagaggaattccctccacttcag
ccaattcttcagcagaagaaagaaaaagacatcattgagaaaacaataaactttgccaga
ttttgtgcccatgaaaactgtactgctgatctacaggtttctgcaaaaattggatttttg
aaaccacatgaaaataagacctatcttgctgttggaagtatgaagacattgatgttgaac
gtgtctttatataatgctggagatgacgcatatgagacaactctgcatatcaaactcccc
accggtctttacttcattaagattttagatctggaagagaaacaaataaactgtgaagta
acagacagctccggcatagtgagacttgactgcagggttggttatatatatgtagatcat
ctatcaaagacagatgttagctttcttctggatgccagctcactcagcagagcagacgag
gatctcaacatcacagtacatgccgcctgtgaaaatgaaggggaaacaggcgatgtgaag
cgtaataaggtgactgtgacaatacctcttaagtatgaagtcatgctaacagttcatggg
tttgtaagtccagcctcatttatgtatggaccaaaggaggaagatgrgtttgaaatgtgc
acgacagagaaaatgaacttcactttccacgtcatcaacaccggccaaagcatggctcca
aatattggtgtggaaataatgataccaaattcttttagtccccgaaccgataagctgttc
aacattttggatgtccagactactgctggagaatgccattttaagaattatcaaagaaag
tgtgcattggaccagaaaaaaggcacaatggagaccctcaaagatatattcagatttctg
tcaaagactgataagaggctcctgtactgcatgaaagctgatccatattgcttaaatatc
tcatgccattttgggaaaatggacagtggaaaagaagccagtgttcacattcagttggaa
ggtcggccatccattttagaaatggatgagactaaagcattgaagtttgaaataagagca
acagcttttccggagccaaatcccaaagttattgaactaaagaaggatgagaatgttgca
catgttctcctcgaaggactacatcatcaaagacctagacgccatttcactataatgatt
atttcaagtagcttgctacttggacttattttgcttttcttcatttcttatgttatgtgg
aaggctggcttcttcaaaagacagtaccaatctatcctacaaaaagaaaacagaagagac
agttggagttacattaacagtaaaagtgataaagatgattga

KEGG   Bos indicus (zebu cattle): 109566462
Entry
109566462         CDS       T04792                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04640  Hematopoietic cell lineage
biu04810  Regulation of actin cytoskeleton
biu05145  Toxoplasmosis
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05222  Small cell lung cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109566462 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109566462 (ITGA6)
   04514 Cell adhesion molecules
    109566462 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109566462 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109566462 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109566462 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566462 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109566462 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109566462 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109566462 (ITGA6)
   05414 Dilated cardiomyopathy
    109566462 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109566462 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109566462 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109566462 (ITGA6)
   04515 Cell adhesion molecules [BR:biu04515]
    109566462 (ITGA6)
   04090 CD molecules [BR:biu04090]
    109566462 (ITGA6)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109566462 (ITGA6)
  Exosomal proteins of breast milk
   109566462 (ITGA6)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109566462 (ITGA6)
CD molecules [BR:biu04090]
 Proteins
  109566462 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 109566462
NCBI-ProteinID: XP_019826390
UniProt: A0A6P5CL56
LinkDB
Position
2
AA seq 1091 aa
MAAAGRLWLLYLSVGLLPRLGTAFNLDTREDNVIEKTGDSGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAVALPLQKANRTGGLYSCDITSRGPCTRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQXGVAATFTKDFHYIAFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDLKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRSGEVGGAAYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDGKGKVFIYHGSANGINTK
PTQVLEGKSPFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQQTITVTPNR
IDLRQKTLCGAPSGICLKVKACFEYTAKPTGYNPSITIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYSQELTLNRQKQKACMEETLWLQENIRDKLRPIPITASVEIQEPSTRRRVNSL
PEVLPILNSNEPKFVHTDVHFLKEGCGDDNICNSNLKLEYKFCTREGNQDKFSYLPIHKG
VPELVLKDQKDIALEITVTNSPSNPKNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLASITATAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEEDVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQGEINFLKLTEAHNSRR
KREIAERQTDDGRKFSLFSEXKYQTLNCSVNVNCVNIKCPLRGLDSKASVVLRSRLWNST
FLEEYSKMNYLDILVRASIDVIAATENIKLPNAGTQVRVTVFPSKTVAQHSGVPWWIILV
AILAGILMLGLLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEEREIPDEKYNDNPEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcggccgcggggcggctgtggctgctttacctgtcagtggggctcctgccgcggctc
ggcaccgccttcaacttggacacccgcgaggacaatgtgatcgagaaaactggggactcc
gggagccttttcggcttctcgctggcgatgcactggcagctgcagcctgaggacaagcgg
ctattgctcgtgggggctccccgtgcagtggcccttccactgcagaaggccaacagaaca
ggaggcttgtacagctgcgacatcacctcccgggggccgtgcacgcgaattgaatttgat
aacgacgctgacccttcatcggaaagcaaggaagatcagtggatgggagtcactgtccaa
agccagggtccaggcggcaaagttgtgacatgtgctcatcgatatgaaaaaagacaacat
gttaatacgaagcaggaatcccgagacatctttggaaggtgctacgtcctaagtcagaat
ctcaggattgaagatgatatggatggaggagactggagtttttgtgatggccggttgaga
ggtcatgaaaaatttggttcttgccagcmaggtgtagcagctacttttactaaagacttc
cattacattgcgtttggagccccaggcacttacaactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgaccatgatgaaagtctagttcctgttcctgctaacagttatttaggcttt
tctttggactcggggaaaggtattgtttccaaagatgagatcactttcgtgtctggtgct
cctagagccaatcatagtggagcggtggttttgcttaaaagagacctgaagtctgcgcac
cttctccctgagcacatatttgatggggaagggctggcttcttcatttggctatgacgta
gcagtggtggacctcaacaaagacgggtggcaagatatagttattggagccccacagtat
tttgatagaagtggagaagttggaggtgcagcgtatgtctacattaaccagcaaggcaga
tggaataacgtcaagccgattcgtcttaatggaaccaaagattctatgtttggcattgca
gtcaaaaatattggtgatattaatcaagatggctacccagatattgcggttggagcaccc
tatgatggtaaggggaaggtttttatctatcatggatctgcgaatggaataaataccaaa
ccaacacaggttcttgagggtaagtcacccttttttggatattcaattgctggaaacatg
gaccttgatagaaattcctaccctgatgttgctgttggttctctctcagattcggtgact
attttcagatcccggcctgtgattaatattcagcaaaccatcacagtaacacccaacaga
attgatctccgtcagaaaacgctctgtggggcgcctagtgggatatgcctcaaggttaag
gcctgttttgaatatactgctaaacccaccggttacaatccttcaataaccattgtgggc
actctggaggctgaaaaggaaagaagaaaatctgggctgtcgtcaagagttcagtttcga
aaccaaggttctgagcccaagtattcgcaagagctcactctgaacagacagaaacagaag
gcgtgcatggargaaaccctctggctccaggaaaacatcagagataaactgcgtcccatt
cccataactgcttcagtggagatccaggagccaagcactcggaggcgagtgaattcgctt
ccagaagttctcccaattctaaattcaaatgaacccaagtttgttcatacagatgtgcac
ttcttaaaagagggatgtggagacgacaacatatgtaacagcaaccttaagctagagtat
aaattttgtacccgagaaggaaatcaggacaagttttcttatttaccaattcacaaaggt
gtaccagaactagttctaaaagatcagaaggacattgctttagaaataacagtgacgaac
agcccttctaacccaaagaatcccaccaaagatggtgacgacgctcacgaagctaaactc
attgccacttttccagacactctgacttactctgcatatagagaactgagggctttccct
gagaagcagttgagttgtgttgccaaccagaatggctcacaagcagactgtgagcttggg
aatccttttaaaagaaattccagtgttactttttatttgattttaagtacaactgaggtc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaagat
aatttggcttcaattacagctacagcaaaagtggttattgaactgcttttatcggtctcc
ggggttgctaaaccttcccaggtgtattttggaggtacagtagttggtgagcaagcgatg
aaatctgaagaggacgtgggaagtttaattgagtacgagttcagggtaattaacttgggc
aaacctcttaaaaacctcggcacagcaaccttgaatatccagtggccaaaagaaattagc
aacggcaaatggttgctttatttggtgaaagtagaatcaaaaggattggaaaaaataact
tgtgagccacagggtgaaataaacttcctgaaactaacggaggctcacaactcaagaagg
aaacgagaaattgctgaaagacagacagatgatggcagaaaattttctttattttctgaa
rgaaaatatcagacccttaactgcagcgtgaacgtgaactgtgtgaacatcaagtgcccg
ctgcgagggctggacagcaaggcctccgtggtcctgcgctcgaggttatggaacagcacg
tttctagaggaatactccaagatgaactacttggacattctcgtgcgggcttccattgat
gtcattgccgccaccgagaatatcaagctgcccaacgcaggcactcaggttcgcgtgact
gtgtttccctcaaagactgtagctcaacattcaggagtaccttggtggatcatcctagtg
gccattcttgctgggattttgatgcttggtctattagtatttttactgtggaagtgtgga
ttctttaaacgctctaggtacgatgatagcgttccccgataccacgctgtaaggatccgg
aaagaagagcgagagatcccagatgaaaaatataatgataaccctgaaaaaaaacagtgg
atcacaaagtggaatgaaaatgaaagctactcctag

KEGG   Bos indicus (zebu cattle): 109574210
Entry
109574210         CDS       T04792                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04640  Hematopoietic cell lineage
biu04810  Regulation of actin cytoskeleton
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05222  Small cell lung cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109574210 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109574210 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109574210 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109574210 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109574210 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574210 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109574210 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109574210 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109574210 (ITGA3)
   05414 Dilated cardiomyopathy
    109574210 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109574210 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109574210 (ITGA3)
   04515 Cell adhesion molecules [BR:biu04515]
    109574210 (ITGA3)
   04090 CD molecules [BR:biu04090]
    109574210 (ITGA3)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109574210 (ITGA3)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109574210 (ITGA3)
CD molecules [BR:biu04090]
 Proteins
  109574210 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LYRIC
Other DBs
NCBI-GeneID: 109574210
NCBI-ProteinID: XP_019837625
UniProt: A0A6P5DJW2
LinkDB
Position
19
AA seq 1050 aa
MGPGPSRAAGVLRPLLGMLALMVAASNRAASAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVPDGYTNRTGAVYLCPLTAHKNDCERMDIKEKSNPNHIIED
MWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDARDDWQTYH
NEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYKD
PEDQGNLYIGYTMQVGSAILHPTNITIVTGAPRHQHVGAVFLLSQEAGGDLRRRQVLEGT
QVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYIFMNQAGTSFPDHPSLLL
HGPSRSAFGFSVASIGDVNQDGFQDIAVGAPFEGLGKVYIYHGSSRGLLRQPQQVIHGEQ
LGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDRIVLLRARPVINILHKTLVAKPSILD
PAFCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLHFARSQSAVFHG
FFSMPEMRCQTLELLLMDNVRDKLRPITISMNYSLPLRLPDRPQLGLGSLDAYPVLNQAQ
ALENHTEVQFQKECGQDNRCDSNLQMRAAFVSELGQRLSRLQYRRDLRKLLLSINVTNTP
SRKRAGEDAHEALLTLEVPPTLLLSSVRPPGACQANETIVCELGNPFKRNQRMELLIAFE
VIGVTLHTRELQAQLQLSTSSHQDDLRPMTLPLLVDYTLQASLSMVNHRLQSFFGGTVMG
ESGMKTVEDVGSPLKYEFQVGPMGEGLAALGTLVLGLEWPYEVXNGKWLLYPTEITVHGN
GSWHCQPPGDLINPLNLTLSVPGDGPPSPQRRRRQLDPGGGQGPPPVTLAAXKKAKSEIQ
LSCGSDHTHCVWLECPIPDAPVITNVTIQARVWNSTFIEDYRDFDRVRVASWATLFLRTG
VPTINMENKTVRFSVDIDSDLVEELPAEIELWLVLVAVSAGLLLLGLIILLLWKCGFFKR
ARTRALYEAKRQKAEMKSQPSETERLTEDY
NT seq 3153 nt   +upstreamnt  +downstreamnt
atgggccccggccccagccgtgccgccggcgtcctacgcccgttgctcggcatgctcgcc
ttgatggtggccgcaagcaaccgcgccgcctccgccttcaacctggacacccgattcctg
gtggtgaaggaggccgggaacccgggcagcctcttcggttactcggtcgccctccatcgg
cagacagagcgacagcagcgctacctgctcctggctggcgccccccgggacctcgctgtg
cctgatggctataccaaccggactggtgctgtgtacctgtgcccactcactgcccacaag
aatgactgtgagcggatggacatcaaggagaaaagtaaccctaaccacatcattgaggac
atgtggctcggcgtgactgtggccagccagggtcctgcaggcagagtcctggtctgtgcc
caccgctacacccaggtgctgtggtccgggtcagaggaccagcggcgcatggtgggcaag
tgctatgtgagaggcaacgacctggagctggacgccagggatgactggcagacctaccac
aacgagatgtgcaacagcaacactgactacctggagacgggcatgtgccagctgggcacc
agcggcggcttcacccaaaacaccgtgtactttggcgctcctggtgcctacaactggaaa
ggaaacagctacatgattcagcggaaggactgggatttgtctgaatatagttacaaggac
ccagaggaccaaggaaacctctatattggctacacgatgcaggtgggcagtgccatcttg
caccccacaaacatcaccattgtgacaggtgccccgcggcaccaacatgtgggcgctgtc
tttttgctgagccaggaagcaggtggagacttgcggaggaggcaggtgctggagggcacg
caggtgggagcctattttggcagtgccattgccctggcagacctgaacaatgatgggtgg
caggacctcctggtgggtgccccctattactttgagcggaaagaggaagtagggggtgcg
atttatatcttcatgaaccaggcaggcacctccttcccagaccacccctccctccttctt
catggccccagtcgctccgccttcggcttctctgtggcaagcattggtgacgtcaaccaa
gacggattccaggacattgctgtgggagccccattcgagggcttgggcaaagtgtacatc
taccatggcagctccagggggctcctcagacagccccagcaggtaatccatggagagcag
ctgggactgcctggcttggccacctttggctactccctgagtgggcagatggacgtggat
gagaacttctacccagacctgctggtggggagcctgtcagaccgcatcgtgctgctgagg
gcccggcctgtcatcaacatcctccataagaccttggtagccaagccatccatactggac
cctgcattctgcacggccacctcctgtgtgcaggtggagctgtgctttgcttacaaccag
agtgcaggcaaccccaactacaggcggaacatcaccctggcctacacgctggaggctgac
cgggaccgccgcccaccccgactccactttgcacgcagccagtcagctgtcttccacggc
ttcttctccatgcctgagatgcgctgccagacactggagctgctcctgatggacaacgtc
cgcgacaaactccgacccatcaccatctccatgaactactcgttacctttgcggttgcct
gatcgtccccaactggggcttgggtccctggatgcctacccggtcctcaaccaagcgcag
gctctggagaaccacacggaggtacagttccagaaggaatgcgggcaggacaacaggtgc
gacagcaatttacagatgcgggcggccttcgtgtctgagctggggcagcggctgagcagg
ctccagtacaggagagacctccgaaaactgctcctgagcatcaacgtgaccaacacccca
agccggaagcgggctggggaagatgcccacgaggcgctcctcaccctggaagtgcctccc
accctgctgctgtcctcagtgcgcccccctggrgcctgccaagccaatgagaccatcgtt
tgtgagctggggaacccctttaaacggaaccagaggatggagctgctcattgctttcgag
gtcatcggagtgaccctacacacaagggaactccaggcgcagctgcagctctccacgtca
agtcaccaggatgacctacggcccatgaccctgcctctgctggtggactacacactccag
gcctcactcagcatggtgaatcaccggctacaaagcttctttggggggacagtgatgggt
gagtctggcatgaaaactgtggaggatgtgggaagccctctcaagtacgagttccaggtg
ggcccaatgggtgaagggctggcagccctggggaccctggtcctggggctggagtggccc
tatgaagtcrgcaatggcaagtggctgctgtaccccacggagatcactgtccatggcaat
ggatcctggcactgccagccgcctggagaccttatcaaccctctcaayctcactctctct
gttcctggggacgggccgccatctccacagcgcaggcggcgacaactggacccaggagga
ggccaaggccccccgcctgtcactctggctgctsccaaaaaggccaagtctgagatccaa
ttgagctgtggcagtgaccacacccactgtgtgtggctggagtgccccattcctgatgcc
cctgtcatcaccaacgtgaccatccaggcacgagtgtggaacagcaccttcatcgaggat
tacagagactttgaccgagtcagggtagccagctgggccaccctgttcctccgaactggc
gtccccaccatcaacatggagaataagacagtccggttttccgtggacattgactctgac
ttggtggaggagctgccggctgagattgagctgtggctggtgcttgtggctgtgagtgcc
gggctgctgctgctggggctgatcatcctcttgctgtggaagtgcggcttcttcaagcga
gcccgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccagccg
tcagagacggagaggctgacggaagactactga

KEGG   Bos indicus (zebu cattle): 109574799
Entry
109574799         CDS       T04792                                 

Gene name
ITGA1
Definition
(RefSeq) integrin alpha-1
  KO
K06480  integrin alpha 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04640  Hematopoietic cell lineage
biu04810  Regulation of actin cytoskeleton
biu05165  Human papillomavirus infection
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109574799 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109574799 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109574799 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109574799 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109574799 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109574799 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109574799 (ITGA1)
   05414 Dilated cardiomyopathy
    109574799 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109574799 (ITGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109574799 (ITGA1)
   04515 Cell adhesion molecules [BR:biu04515]
    109574799 (ITGA1)
   04090 CD molecules [BR:biu04090]
    109574799 (ITGA1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109574799 (ITGA1)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109574799 (ITGA1)
CD molecules [BR:biu04090]
 Proteins
  109574799 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 LYRIC Integrin_alpha VWA_CoxE Cation_ATPase_N
Other DBs
NCBI-GeneID: 109574799
NCBI-ProteinID: XP_019838317
UniProt: A0A6P5DML7
LinkDB
Position
20
AA seq 1179 aa
MDPGRRASPGVAVAYCWLLSVVLRFCVSFNIDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRSESLPCIKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPKGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGS
NSIYPWESVTAFLNDLLKRMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLNKVIQDCEDE
SIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVEALGERIF
ALEATVDQSAASFEMEMSQTGFSAHYSQDWIMLGAVGAYDWNGTVVMQKADQSVIPQNTT
FNVESTKKNEPLASYLGYTVSSATTPGDVLYIAGQPRYNHTGQVVIYRMEGRDIRILQTL
NGEQIGSYFGSVLTTIDIDKDSNTDILLVGAPMFMGREKEEQGKVYVYALNQTRFEYQMS
LEPIKQTCCSSLKHNSCTKENRNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHGG
AVYIYHGSGKTIREEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAAL
FWSRDVAVVKVTMNFEPNKVNIQKKNCRVEGKETVCINATVCFNVKLKSKENVVYEADMQ
YRVTLDSLRQISRSFFSGTQERKIQRNITVRESECTKHSFYMLDKHDFRDSVRITLDFNL
TDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCVSDLALDVSTTEKGLLIVKSHNDKFNV
SLTVKNKKDSAYNTRTIVNYSPNLIFSGIEAIQKDSCESNHNITCKVGYPFLRKGEMVTF
KILFQFNTSYLMENVIIHLSATSDSEEPPETLFDNEVNISXPVKYEVGLQFFSSASEYHI
SIAANETVPEIINSTEDLGNEIDIFYLIRKSGHFPMPELKLTISFPNVTSDGFPVLYPSG
WSSSENVNCIPSNLQDPFGINTGKKMMISKSEDIKRGTILDCSACKFATITCNLIPSDMS
QVNVSLILWKPTFIXAHFSSLNLTVRAELQSENATLVLSAGNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggaccccgggcgccgcgccagcccaggggtcgctgtcgcctactgctggctcctctcc
gttgttctrcgcttctgtgtgtcattcaatattgatgtgaaaaactcaatgactttcagc
ggcccagtggaggacatgtttggatatactgtccaacaatatgaaaacgaagaagggaaa
tgggtgcttattgggtctcctttagttggccaacccaagaacagaactggagatgtctat
aaatgtccagttgggcgaagtgaatcattaccttgcataaagttggatctcccagttaat
acatcaattcccaatgtcacggaagtaaaggagaacatgacatttggatcaactttagtc
accaacccaaaaggagggtttctggcatgtgggcccttgtatgcctatcgatgtggacat
ttgcattacacaactggaatctgttctgatgtcagccccacatttcaagtcgtgaactcc
attgcccctgtacaagaatgtagcactcagctagacatagtcatcgtgctggatggttct
aacagcatttatccctgggaaagtgttacagcttttttaaatgaccttcttaaaagaatg
gatattggtcctaaacagacacaggttggaattgtacagtatggagaaaatgtaactcat
gagttcaacctcaataagtactcatcaacagaagaggtgcttgttgcagcaaaaaaaata
gtccagagaggtggccggcagaccatgacagcccttggaatagacacagcaaggaaagag
gctttcactgaagcccggggtgcccgaagaggggttaaaaaagtcatggtaattgtgacg
gatggagagtcccatgacaaccaccggctgaataaggtcatccaggactgtgaggatgaa
agcattcagcggttttccatagctattcttggcagctataaccgaggaaatttgagcact
gaaaaatttgtggaggaaataaaatcaatagcaagtgaacccactgaaaagcatttcttc
aatgtctctgatgaattggcattagtcactattgttgaagctctgggagaaagaatcttc
gccctggaagcgacwgtggaccaatcggcagcatcttttgagatggaaatgtctcagact
ggcttcagtgctcattattcacaggactggatcatgcttggagcagtaggagcctatgat
tggaatggaacagttgtcatgcagaaggctgatcaaagcgtaattccccagaacacaacc
tttaatgttgagtccacaaagaagaatgaacctcttgcttcttatttaggttacacagta
agctctgccactactcctggagatgtgctctacattgctggacagccgaggtacaatcac
acaggccaggttgtcatctacagaatggagggcagagacatcaggattctccagacactc
aatggagaacagatcggttcctactttggaagtgttttaacgacaattgacattgataaa
gattctaatactgacattcttctagtcggggctcccatgttcatgggaagagagaaggaa
gaacaaggaaaagtgtatgtctacgctctgaatcagacaaggtttgaatatcaaatgagc
ctggaacccattaagcagacttgttgttcatctctgaagcacaactcatgcacaaaggaa
aacagaaacgagccatgtggggctcgttttggaacagctattgctgctgtgaaagatctc
aaccttgatgggtttaatgacatcgtgatcggagcgcccctggaagatgatcatggagga
gctgtgtacatttatcacggaagtggcaagactataagagaggagtacgcacaacgtatt
ccatcagggggagatggcgagacactgaaattttttggccagtctattcacggagaaatg
gatttaaatggtgatggtctgactgatgtcactattgggggccttggtggtgctgccctc
ttctggtctcgagatgtggctgtcgttaaagtgaccatgaattttgaacccaataaagtg
aatattcaaaagaagaactgccgtgtggagggaaaggaaacggtgtgtataaatgccacg
gtgtgtttcaatgtgaaactgaagtccaaagaaaacgtggtttatgaagctgatatgcag
taccgtgtcacattagattctctaaggcagatatcacggagttttttctctggaactcaa
gagaggaagattcaaagaaacatcacagttcgagagtcagaatgcactaagcattccttc
tacatgttggacaagcatgactttcgggattctgtgagaataactttggattttaatctt
acygatccagaaaatgggcctgttcttgatgattctctaccaaattcagtacatgaatat
attccctttgccaaagattgtggaaacaaggaaaaatgtgtctcggaccttgccttggat
gtatccaccacagaaaarggcctgcttattgtcaagtcccacaatgataagttcaatgtt
agcctcacagtcaaaaataaaaaggacagtgcctataacaccagaaccatagtgaattat
tctccaaatctaattttttcaggaattgaggctatccaaaaagacagttgtgaatccaat
cataatatcacatgtaaagttggctatcctttcctaagaaaaggagagatggtaacattc
aaaatattatttcagtttaacacatcttatctcatggaaaatgtgatcattcatttaagt
gcaacaagtgacagtgaagagccgcctgaaaccctttttgataatgaagtgaacatttct
rtccctgtaaagtatgaagttggactacagtttttcagctctgcaagtgaataccatatt
tcaattgcggccaacgagactgtccctgaaatcattaattctactgaggaccttggaaac
gaaattgatatcttctacttgattagaaaaagtgggcattttccaatgccagaacttaaa
ctgacaatttcatttcccaatgtgacgtcggatggttttcctgtactgtacccaagtgga
tggtcatcttccgagaacgtcaactgcatacccagtaaccttcaggatccttttggtatc
aacactgggaagaaaatgatgatatccaaatctgaagatatcaaacgaggcaccattctg
gactgcagtgcgtgtaaatttgccaccatcacgtgtaacctgattccgtctgacatgagc
caagtgaatgtttcacttatcttatggaaaccaacttttataraagcacatttttccagc
ttaaatcttactgtaagggcagaacttcagagtgaaaatgcaacactagttctaagtgct
ggcaatcaaaaaagagagcttgctatccaaatatccaaagatgggctaccaggcagagtg
ccactgtgggttatcctgctgagtgcttttgctggattattgctattaatgttgctcata
ttagcactgtggaagattggattcttcaaaagaccactaaagaagaaaatggagaartga

KEGG   Bos indicus (zebu cattle): 109574862
Entry
109574862         CDS       T04792                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04611  Platelet activation
biu04640  Hematopoietic cell lineage
biu04810  Regulation of actin cytoskeleton
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05222  Small cell lung cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109574862 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109574862 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109574862 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109574862 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109574862 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109574862 (ITGA2)
   04611 Platelet activation
    109574862 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574862 (ITGA2)
   05205 Proteoglycans in cancer
    109574862 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109574862 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109574862 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109574862 (ITGA2)
   05414 Dilated cardiomyopathy
    109574862 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109574862 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109574862 (ITGA2)
   04515 Cell adhesion molecules [BR:biu04515]
    109574862 (ITGA2)
   04090 CD molecules [BR:biu04090]
    109574862 (ITGA2)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109574862 (ITGA2)
  Exosomal proteins of bladder cancer cells
   109574862 (ITGA2)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109574862 (ITGA2)
CD molecules [BR:biu04090]
 Proteins
  109574862 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha HisK_sensor CHB_HEX_C_1
Other DBs
NCBI-GeneID: 109574862
NCBI-ProteinID: XP_019838422
UniProt: A0A6P5DN11
LinkDB
Position
20
AA seq 1179 aa
MXPGRTGGTPLQLVLVFSQGILNCCVAYNVGLPKAKIFSGPSSEQFGYAVQQFINPKGNW
LLVGSPWSGFPKNRMGDVYKCPVDLSTTTCEKLNLQTSTSMSNVTEMKTNMSLGLTLTRN
VGTGGFLTCGPLWAQQCGSQYYTTGVCSDVSPDFQLRTSFAPAVQTCPSFIDVVVVCDES
NSIYPWDAVKNFLEKFVQGLDIGPTKTQMGLIQYANNPRVVFNLNTFKSKDEMIKATSQT
FQYGGDLTNTFKAIQYARDTAYSTAAGGRPGATKVMVVVTDGESHDGSKLKAVIDQCNKD
NILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERHFFNVSDEADLLEKAGTIGEQIF
SIEGTVQGGDNFQMEMSQVGFSAEYSPQNNILMLGAVGAYDWSGTVVQKTPHGHLIFSKQ
AFEQILQDRNHSSYLGYSVASISTGNSVHFVAGAPRANYTGQIVLYSVNENGNVTVIQSH
RGDQIGSYFGSVLCAVDVNKDTITDVLLVGAPMYMNDLKKEEGRVYLFTITKGILNWHQF
LEGPXGLENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHEGMIRLRYSQ
KILGSDRAFSSHLQYFGRSLDGYGDLNGDSITDVSVGAFGQVVQLWSQSIADVSVDASFT
PKKITLLNKNAEIKLKLCFSAKFRPTNQNNQVAIVYNITIDEDQFSSRVISRGLFKENNE
RCLQKTMIVSQAQXCSEYIIHIQEPSDIISPLNLCMNISLENPGTNPALEAYSETVKVFS
IPFHKDCGDDGVCISDLVLNVQQLPATQQQPFIVSNQNKRLTFSVQLKNKKESAYNTEIV
VDFSENLFFASWSMPVDGTEVTCQIASSQKSVTCNVGYPALKSKQQVTFTINFDFNLQNL
QNQASISFRALSESQEENMADNSVNLKLSLLYDAEIHITRSTNINFYEVSLDGNVSSVVH
SFEDIGPKFIFSIKVTTGSVPVSMASVIIHIPQYTKDKNPLMYLTGVHTDQAGDISCEAE
INPLKIGQTSSSVSFKSENFRHIKELNCRTASCSNIMCWLRDLQVKGEYFLNVSTRIWNG
TFAASTFQTVQLTAAAEIDTYNPQIYVIEENTVTIPLTIMKPHEKVEVPTGVIVGSVIAG
ILLLLALVAILWKLGFFKRKYEKMAKNPDETDETTELNS
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgyggccaggacggacaggcggcacgccgctgcagctggtgttagtgttcagtcaaggc
attttaaactgttgtgtggcatacaacgttggtctcccaaaagcaaagatattttctggt
ccttcaagtgaacagtttggctatgcagtgcagcagtttataaatccaaaaggcaactgg
ttactggttggttcaccatggagtggctttcctaagaaccgaatgggagatgtatataaa
tgtcctgttgatctatccaccactacatgtgaaaaattgaatttgcaaacttccacgagc
atgtccaatgttactgagatgaaaaccaacatgagccttggcttgacactgacaaggaac
gtgggaacaggaggatttcttacctgtggtcccctgtgggcacagcagtgyggaagtcag
tattacacaaccggcgtttgctctgatgtcagtcctgattttcagttgcggaccagcttt
gcgcctgcagttcagacctgcccttccttcatagatgttgtggttgtatgtgatgaatca
aacagtatttatccctgggatgcagtaaagaactttttggaaaaatttgtacaaggccta
gatataggccccacaaagacacagatggggttaattcaatatgccaataatccaagagtt
gtgtttaacctgaatacttttaaatccaaagatgaaatgattaaagcaacatcgcagaca
ttccaatatggtggagaccttacaaataccttcaaagcaattcagtatgcaagagatacc
gcttattcaacggctgctggtggacgaccaggtgctaccaaagttatggtggttgtaact
gatggtgaatcccatgatggttcaaagttgaaagctgtgattgatcaatgtaacaaagac
aatatactgaggtttggcatagcagttcttgggtacttaaacagaaacgccctggatact
aaaaatttaataaaggaaattaaagctattgccagtattccaacagaaagacactttttc
aatgtctctgatgaagcagatctactagaaaaggctgggacaataggagaacaaattttc
agcattgaaggtacagttcaaggaggagacaacttccaaatggaaatgtcgcaagtggga
ttcagcgcggaatactctcctcaaaataatattctgatgctgggtgcagtaggagcttac
gactggagtgggactgtggtgcagaagacacctcatggacatttgatcttttctaaacaa
gcgtttgaacaaattctgcaagacagaaatcacagytcatatttaggttactctgtggct
tcaatttctactgggaacagtgtccactttgttgctggtgctcctcgagcaaattatact
ggccagatagtgctctacagtgttaatgagaatggcaatgtcacagttattcagtctcac
agaggtgaccagattggctcctattttggtagtgtgctgtgtgcagtcgatgtgaataag
gacaccattacagatgtgctcttggtaggtgcrccaatgtacatgaatgacctaaagaaa
gaggaaggaagagtctacctgtttactattacaaagggcattttgaattggcaccaattt
ctggaaggccccaakggtcttgaaaatgctcgatttggttcagcaattgcagctctttca
gacatcaacatggatggctttaatgacgtgattgttggttcgcctttggaaaatcagaac
tctggagctgtgtacatctacaatggycatgagggcatgattcgcttgaggtattctcag
aaaatcctggggtccgacagagcctttagtagccacctccagtactttgggagatccctg
gatggctatggagatttaaatggggattccatcaccgacgtgtccgtgggggcctttgga
caggtcgttcagctctggtcacagagcattgctgatgtatctgtagatgcttcattcaca
ccaaaaaaaatcactttgctcaacaaaaatgctgagataaaacttaaactctgcttcagt
gctaagtttagacctactaatcaaaacaatcaagtggccattgtgtataacatcacaatt
gatgaagaccagttttcatccagagtgatatccagggggttatttaaggaaaataatgaa
aggtgcttgcagaagaccatgatagtaagtcaagcacagmgctgttctgagtacatcatc
cacatacaggagccctctgacattatcagccctctgaatctgtgtatgaacattagtctg
gaaaaccctggcactaaccctgcccttgaagcctactctgagacggtcaaggtcttcagt
atccctttccataaagactgtggtgatgatggagtttgcatttctgatctagttctaaat
gttcagcagctgccagccactcaacaacagcccttcattgtcagcaaccaaaacaaaagg
ttaacattttcagtacaactgaaaaacaagaaggaaagtgcctacaacactgagattgtt
gttgatttttcagaaaacctgttttttgcttcctggtccatgccggttgatgggacagaa
gtracctgccagattgcttcatctcagaagtctgttacctgcaatgtgggctaccctgct
ttaaagagcaaacaacaggtgactttcactattaacttcgacttcaatcttcaaaacctt
cagaatcaggcatctatcagtttccgagccttaagcgaaagccaggaagaaaacatggca
gataattcagtcaacttaaaactctctctgctgtatgatgccgaaattcacataacaaga
tctaccaacataaatttttatgaagtctccttggatgggaatgtttcttctgtcgtgcac
agttttgaagatattggtccaaaattcatcttctccattaaggtaacaacaggaagtgtt
ccagtaagcatggcatctgtgatcatccacatccctcaatacaccaaagacaagaacccr
ctgatgtacctgaccggggtgcacacagatcaggctggtgacatcagttgcgaagccgaa
ataaatccactgaaaataggacagacgtcttcttctgtatctttcaagagtgaaaatttc
cggcacataaaagaattgaactgtagaaccgcttcatgcagtaacatcatgtgctggctg
agagaccttcaggtgaaaggagaatacttccttaatgtgtccacsaggatttggaatggg
actttcgcagcatcgactttccagacagtacagttgacagcagctgcagaaattgacaca
tataaccctcagatatacgtgatcgaagaaaacacggtgacrattccccttacgataatg
aaaccccatgagaaagttgaagtaccractggagtgatagtaggaagtgtaatcgctgga
atccttttgctattagctctagttgcaattttatggaagcttggattcttcaaaagaaaa
tatgaaaaaatggccaaaaatccagatgaaaccgatgagaccacagaactcaacagctga

DBGET integrated database retrieval system