KEGG   Bos indicus (zebu cattle): 109558399
Entry
109558399         CDS       T04792                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04120  Ubiquitin mediated proteolysis
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04625  C-type lectin receptor signaling pathway
biu04919  Thyroid hormone signaling pathway
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109558399 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109558399 (MDM2)
   04151 PI3K-Akt signaling pathway
    109558399 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109558399 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    109558399 (MDM2)
   04115 p53 signaling pathway
    109558399 (MDM2)
   04218 Cellular senescence
    109558399 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109558399 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109558399 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558399 (MDM2)
   05202 Transcriptional misregulation in cancer
    109558399 (MDM2)
   05206 MicroRNAs in cancer
    109558399 (MDM2)
   05205 Proteoglycans in cancer
    109558399 (MDM2)
   05203 Viral carcinogenesis
    109558399 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    109558399 (MDM2)
   05220 Chronic myeloid leukemia
    109558399 (MDM2)
   05218 Melanoma
    109558399 (MDM2)
   05219 Bladder cancer
    109558399 (MDM2)
   05215 Prostate cancer
    109558399 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109558399 (MDM2)
   05169 Epstein-Barr virus infection
    109558399 (MDM2)
   05165 Human papillomavirus infection
    109558399 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109558399 (MDM2)
   01522 Endocrine resistance
    109558399 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109558399 (MDM2)
   04121 Ubiquitin system [BR:biu04121]
    109558399 (MDM2)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109558399 (MDM2)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    109558399 (MDM2)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    109558399 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 109558399
NCBI-ProteinID: XP_019815390
UniProt: A0A6P5BRY5
LinkDB
Position
5
AA seq 289 aa
MSLPLWSLHSNDGRQSTSGEDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLS
EEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPPHCNRC
WALRENWLPEDKGKDKGNMSEKAKLGDSMQEDEGFDVPDCKKSTVSDSRESCVEENDDKI
TQASLSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQDKEESMESSFPLNAIEPCVICQ
GRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
NT seq 870 nt   +upstreamnt  +downstreamnt
atgtcgctgcccctgtggagcttacattctaatgatggaagacagtcgacaagtggtgag
gatctggatgctggtgtaagtgaacattcaggtgattggttggatcaggattcagtttca
gatcaattcagtgtagaatttgaagttgagtctcttgattcagaagattatagcctcagc
gaagaaggacaagaactctcggatgaagatgatgaggtgtatcgagttactgtgtatcag
gcaggcgagagtgatacagattcatttgaagaagatcctgaaatttccttagctgactat
tggaagtgtacttcatgcaatgaaatgaatcctccccttccacctcactgcaacagatgt
tgggcccttcgtgaaaattggcttcctgaagataaaggaaaagataaagggaatatgtct
gagaaagccaaactaggagactcgatgcaagaagacgagggctttgatgtccctgactgt
aagaaatctacggtcagtgattccagagaatcatgtgttgaagaaaatgatgataaaatc
acacaagcctctctgtctcaagaaagtgaggactattctcagccatcgacttctaatagc
atcatttatagtagccaagaagatgtcaaagagtttgagagagaagaaacacaagacaaa
gaagaaagtatggagtctagttttcctcttaatgccattgaaccttgtgtgatttgccag
ggtcgacctaaaaatggttgcatcgtccatggcaaaacaggacatcttatggcatgcttc
acatgtgcaaagaagttaaaaaaaaggaataagccctgtccagtatgtaggcaaccaatt
caaatgattgtactaacttatttcccctag

DBGET integrated database retrieval system