KEGG   Bos indicus (zebu cattle): 109558403
Entry
109558403         CDS       T04792                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00310  Lysine degradation
biu01100  Metabolic pathways
biu04010  MAPK signaling pathway
biu05200  Pathways in cancer
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109558403 (MECOM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109558403 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558403 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109558403 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109558403 (MECOM)
   03036 Chromosome and associated proteins [BR:biu03036]
    109558403 (MECOM)
Enzymes [BR:biu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     109558403 (MECOM)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    109558403 (MECOM)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109558403 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_11 zf-BED zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 109558403
NCBI-ProteinID: XP_019815394
UniProt: A0A6P5BRX4
LinkDB
Position
1
AA seq 1240 aa
MRSKGRARKLATNNECVYGSYPEIPLEEMPDADGVAGALSLSIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWSKRKIEAGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEDDFQQKPETENDLREIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIXHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFAT
SSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSS
LNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFXANRHPAGL
TFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQ
DILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGS
DLESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVN
DSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLP
LKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTPVPAKPSATPAASQDQPLDLSMGS
RSRASGTKLTEPRKNHVFGEKKGGNIEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDP
LEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLEXFSALKPEASELLQSVPSM
FNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFS
ISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELES
TGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNAEERMNGSHFKDEKALVTNQNSDLLDDE
EVEDEVLLDEEDEDNDITGKMGKEPGTSNLHEGNPEDDYEDTSTLEMSCKASPMRYKEEE
YKTGLSALDHIRHFTDSLKMRKMEDNQYTEAEVSSFSASHVPEELKQPLHRKSKSQAYAM
MLSLSDKESLHSSSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3723 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaaataatgagtgtgtatatggcagc
taccctgaaattcctttggaagaaatgccagatgcagatggagtagctggtgctctgtcc
ctcagtattcaggagccatgctctccagccacatccagtgaagcgttcactccaaaggag
ggctctccttacaaagcccccatctacatccctgatgatatccccattcctgctgagttt
gaacttcgagagtcaaatatgcctggagcaggccttggaatatggagcaaaaggaaaatt
gaagccggtgaaaagtttgggccttatgtgggagagcagagatcaaacctgaaagaccct
agttacggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcagcac
aacctcgttgcatgccagataaatgatcagatattttatagagtagtcgcagacattgca
ccaggagaggagctcctgctgttcatgaagagtgaagactattcccatgaaactatggca
ccagatatccacgaagaacggcagtaccgctgtgaggactgtgaccagctctttgagtcc
aaggccgagctagcagaccaccagaagttcccatgcagcactccccattcggctttctca
atggtagaagacgacttccaacaaaagcccgagactgaaaatgatctccgagagatacat
gcgattcaggagtgtaaggaatgtgaccaagtgtttcccgacttgcaaagcttggagaaa
cacatgttgtcacatactgaagagagggaatacaagtgcgatcagtgtcccaaagcattt
aactggaagtccaatttaattcrccaccagatgtcacatgacagtggaaagcactatgaa
tgtgagaactgcgccaagcaggttttcacggaccctagcaaccttcagcggcacatccgc
tctcagcatgttggtgcccgggcccacgcgtgccccgagtgtggcaaaacgtttgccact
tcgtcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgag
gtctgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgct
gattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcc
ttaaataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggatttttt
ggccaaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatg
agtcatgccaacccgggccttgctgactattttngcgccaataggcatcctgctggtctt
acctttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttg
taccacaggcctcctttgatacctgctagttctcctgttaaaggactgtcaagtactgaa
cagacaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacag
gatattttgaaggcactatctaaacacccacctgtaggggacaataagccagtggagctc
cagcccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagt
agtgaccttgatgatgtcagtacgccaagtggcagtgacctggaaacaacctcgggctct
gatctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttc
aaagacaaagtaagccctcttcagaatctggcttcaatacataataagaaagaatacagc
aatcattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaat
gattctataaaggctattgcttctattgctgaaaaatactttggttcaacaggactggtg
gggctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccattt
tttccagcattctctcaatcaatgtacccatttcctgatagagacttgagatcgttacct
ttgaaaatggagccccaatcaccaagtgaagtaaagaaactgcagaagggaagctctgag
tctccctttgatctcaccactaaacgcaaggacgagaagcccttaaccccagtacctgcc
aagccttcagcgaccccggctgcaagccaagaccagcccctggatctaagtatgggcagt
aggagtagagccagtgggaccaagctgactgagcctcgtaaaaaccacgtgtttggggag
aagaaaggaggcaacattgaaccaagaccagcatccgatggttccttacagcatgctaga
cccactcctttctttatggaccctatttacagagtagagaaaagaaaactaactgaccca
cttgaagctttaaaagagaaatacttgaggccttctccaggattcttatttcacccacaa
ttccaactgcctgatcagagaacttggatgtcggctattgaaaacatggcagagaagctg
gagarcttcagtgccctgaaaccagaggccagtgaacttctacagtctgttccctccatg
ttcaacttcagagctcctcccaacgccctgccagagaacctcctacggaaaggaaaggag
cgctatacctgcagatactgtggtaagatttttccaagatctgcgaacctaacacggcac
ttgagaacccacacaggagagcagccttatagatgcaagtactgtgacaggtccttcagc
atatcttccaacctgcagcggcatgttcgcaacatccacaataaagagaagccctttaag
tgtcacttatgtgataggtgttttggtcaacaaaccaacttagacagacacctcaagaar
cacgagaatgggaacatgtctggtacggcaacatcatcgcctcattctgaactggaaagc
acaggtgcaatcctygatgacaaggaagacgcttacttcacagaaattcgaaatttcatc
gggaatagcaaccacggcagccagtcccccaggaacgccgaagagagaatgaatggcagt
cactttaaagatgaaaaggctttggtgaccaatcaaaattcagacttactggatgatgaa
gaagtagaagatgaggtgttgttagatgaggaggatgaagacaatgatattactgggaaa
atgggaaaggaaccagggacgagtaatttacatgaaggaaaccccgaggatgactatgaa
gacaccagcaccctggaaatgagctgtaaagcatccccaatgaggtataaagaggaagaa
tataaaactggactttctgctctagatcatataaggcacttcacagatagcctcaaaatg
aggaaaatggaagataatcaatatacagaagctgaggtgtcttctttcagtgcttcccat
gtgccagaggaacttaaacaaccgttacacagaaagtccaagtcacaggcatacgctatg
atgttgtcattgtccgacaaggagtccctgcattcttcatcccacagttcttccaaygtg
tggcatagtatggcgagggctgcagcagaatccagtgccatccagtccataagccacgta
tga

KEGG   Bos indicus (zebu cattle): 109561422
Entry
109561422         CDS       T04792                                 

Gene name
RUNX1
Definition
(RefSeq) runt-related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04530  Tight junction
biu04659  Th17 cell differentiation
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109561422 (RUNX1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109561422 (RUNX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561422 (RUNX1)
   05202 Transcriptional misregulation in cancer
    109561422 (RUNX1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109561422 (RUNX1)
   05220 Chronic myeloid leukemia
    109561422 (RUNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109561422 (RUNX1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    109561422 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 109561422
NCBI-ProteinID: XP_019819421
UniProt: A0A6P5C1F9
LinkDB
Position
1
AA seq 453 aa
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGFPDAGAALAGKLRSGDRSMVDVLADHPG
ELVLTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTASDL
TAFGDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMSSATRYHTYLPPPYPG
SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVSGERSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgcgtatccccgtagatgccagcacgagccgccgcttcacgccgccttccaccgcgctg
agcccgggcaagatgagcgaggcgctgccgctgggcttcccggacgccggcgccgcccta
gccggcaagctgaggagcggcgaccgcagcatggtggacgtgctggccgaccacccgggc
gagctggtgctcaccgacagccccaacttcctctgctccgtgctgcccacgcactggcgc
tgcaacaagaccctgcccatcgctttcaaggtggtggctctgggggacgttccggatggc
actctggtgaccgtgatggcaggcaatgatgaaaactactcagctgaactgagaaatgca
actgcggccatgaaaaaccaagttgcgagattcaatgacctcaggtttgtcggtcggagt
ggaagagggaaaagcttcactctgaccatcaccgtcttcacaaacccaccgcaagtcgcc
acctaccacagagccatcaaaatcacagtggatggaccccgagaacctcgaagacatcgt
cagaaactagatgatcagaccaagcctgggagcttgtccttttccgagcggctcagtgaa
ctggagcagctgcggcgaacggccatgagggtcagcccacaccacccagcccccacaccc
aaccctcgggcctccttgaaccactccactgcctttaaccctcagcctcagagtcagatg
caggatacgaggcagatccagccatccccaccrtggtcctatgatcagtcctaccagtac
ctgggatccatcgcctctccctccgtccacccagccacacccatctcgcctgggcgggcc
agcggcatgacgaccctctcagccgagctttccagtcgactttcaactgcgtccgacctg
acggccttcggcgacccgcgccagttccctgcgctgccctccatctccgacccccgcatg
cactaccccggcgccttcacctactccccaacgcccgtcacgtcaggcatcggcatcggc
atgtcagccatgagctcggccacgcgctaccacacgtacctgccgccgccctaccccggc
tcgtcgcaggcacagggcggcccgttccaggccagctcgccatcctaccacctgtactac
ggcgcgtcggccggctcctaccagttctccatggtgagtggcgagcgctcgccaccacgc
atcctgccgccctgcaccaacgcgtccaccggctcggcgctgctcaaccccagcctcccg
aaccagagcgacgtggtggaggctgagggcagccacagcaactcccccaccaacatggcg
cccgccgcgcgcctcgaggaggccgtgtggcggccctactga

DBGET integrated database retrieval system