KEGG   Bos indicus (zebu cattle): 109558615
Entry
109558615         CDS       T04792                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04260  Cardiac muscle contraction
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04713  Circadian entrainment
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04727  GABAergic synapse
biu04728  Dopaminergic synapse
biu04742  Taste transduction
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04921  Oxytocin signaling pathway
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04927  Cortisol synthesis and secretion
biu04929  GnRH secretion
biu04930  Type II diabetes mellitus
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05031  Amphetamine addiction
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109558615 (CACNA1C)
   04020 Calcium signaling pathway
    109558615 (CACNA1C)
   04024 cAMP signaling pathway
    109558615 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    109558615 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109558615 (CACNA1C)
   04929 GnRH secretion
    109558615 (CACNA1C)
   04912 GnRH signaling pathway
    109558615 (CACNA1C)
   04921 Oxytocin signaling pathway
    109558615 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    109558615 (CACNA1C)
   04924 Renin secretion
    109558615 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    109558615 (CACNA1C)
   04927 Cortisol synthesis and secretion
    109558615 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109558615 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    109558615 (CACNA1C)
   04270 Vascular smooth muscle contraction
    109558615 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    109558615 (CACNA1C)
   04727 GABAergic synapse
    109558615 (CACNA1C)
   04725 Cholinergic synapse
    109558615 (CACNA1C)
   04728 Dopaminergic synapse
    109558615 (CACNA1C)
   04726 Serotonergic synapse
    109558615 (CACNA1C)
   04720 Long-term potentiation
    109558615 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    109558615 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    109558615 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109558615 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109558615 (CACNA1C)
   05020 Prion disease
    109558615 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    109558615 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    109558615 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109558615 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109558615 (CACNA1C)
   05414 Dilated cardiomyopathy
    109558615 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109558615 (CACNA1C)
   04934 Cushing syndrome
    109558615 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:biu04040]
    109558615 (CACNA1C)
Ion channels [BR:biu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109558615 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 109558615
NCBI-ProteinID: XP_019815522
LinkDB
Position
5
AA seq 2007 aa
MGRLQLESALWARVRGHHLENVGGSASEDWTLCACALKRASQLRRGDSELSDRPSGHSVH
QACRPWGLACPFEELPVPDSVTAKPPELGLQVVLNSIIKAMVPLLHIALLVLFVIIIYAI
IGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGIT
NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL
SGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNM
SMPTSETESVNTENVAGGDIEGESCGARLAHRISKSKFSRYWRRWNRFCRRXXXAAVKSS
IFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYF
VSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASL
LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILT
GEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTS
AQKEEEEEKERKKLARTASPEKKQEVVEKPAVEETKEEKIELKSITADGESPPATKINMD
DLQPNENEDKSSYPNQETTXEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFS
PSNRFRLQCHRIVNDSIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIF
TIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLR
PLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQ
TEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRS
IDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDK
NQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTXCLXMQHYGQS
CLFKIAMNILNMLFTGLFTVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSVIDVILSETN
HYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRL
VKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRN
NNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYF
ISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLD
VVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEG
NLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKE
QGLVGKPSQRNALSLQAGLRTLHDSKPLLRRXXSGQLGAAQRGXAPSLPRGPAPSPTALS
VSLLPQRAGGLFGNHVGYYPSDGRGAFPQTFTTQRPLHISKAGNSQGDTESXSHEKLVDS
TFTPSSYSSTGSNANINNANNTALGRCPRPALHSGAVSTLEAHGPPLSPAIRVQEAAWRH
SSQRCPSRDSPIAMLCQEEASGDETCAVHVDENAEHSSEPSLVSTEMLSYQDDENRQLTP
PEEDRRDIRLSPKRGFLRSASLGRRASFHLECLKRQKNPGGDVSQNTVLPLHLVHHQALA
VAGLSPLLQRSHPPGTLPPPRLTPPATPGPAWPPRPVPTLRLEGAESSDKLTSSFPSIHC
DPHIGEPTPCGVVGTPRRARPVSLTVPSPAGPQGRPFHGSASSLVEAVLISEGLGQFAQD
PRFLEATTQELADACDMTIEEMESAADDILSGGAGQSPNGTLLPCANCRDPGPDRAGGVE
DAAWAPSAEPRQGAEEPRDSRAFASGL
NT seq 6024 nt   +upstreamnt  +downstreamnt
atggggagactgcagctggagagtgcgttgtgggccagagtcaggggccatcacctggag
aacgtgggtggcagcgcatcagaagactggacactrtgcgcttgtgctttgaaacgagca
tcccagctgcgacgtggagacagcgagctgagtgaccgacccagcggccacagtgtccac
caggcctgcaggccctgggggctcgcctgtccatttgaagagctccctgtgccagactcg
gtgacagcaaagcccccagagcttggtctccaggtggtcttgaattccatcatcaaggcc
atggtgcccctgctgcacatcgccctgctcgtgctgttcgtcatcatcatctatgccatc
atcggcctggagctcttcatgggcaagatgcataagacctgctacaaccaggagggcatt
gcagatgtcccagcagaagacgacccctcgccctgtgccctggagacaggccacgggcgg
cagtgccagaatggcacggtgtgcaaaccaggctgggatggacccaagcacggcatcacc
aatttcgacaacttcgccttcgccatgctgactgtgttccagtgcatcaccatggagggc
tggaccgacgtcctctactgggtcaatgatgccgtgggaagggactggccctggatctat
tttgtcacattaatcatcataggttcattctttgttcttaacttggttctcggtgtcctt
agcggagagttctccaaagagcgagagaaggccaaggcccggggagacttccagaagctg
cgagagaagcagcagctggaggaggacctgaagggctacctggactggatcacgcaggcc
gaggacatcgaccccgagaatgaggacgagggcctggacgaggagaaaccccgaaacatg
agcatgcccaccagtgagaccgagtctgtcaacaccgaaaacgtggctggaggggacatc
gagggagagagctgcggggccaggctggcccaccggatctccaagtcraagttcagccgc
tactggcgccggtggaatcggttctgcaggaggaannnnngcgcggccgtgaagtccagc
atcttctactggctggtcatcttcctggttttcctcaacacactcaccatcgcctccgag
cactacaaccagccccactggctcacggaagtccaagacacggccaacaaggcgctgctg
gccctgttcacggcggagatgctgctcaagatgtacagcctgggcctgcaggcctacttc
gtgtcgctcttcaaccgcttcgactgcttcatcgtgtgcgggggcatcctggagaccatc
ctggtggagaccaagatcatgtcgccgttgggcatctccgtgctgcgttgcgtgcgcctc
ctkcggatatttaagatcacaaggtactggaactccctgagcaacctggtggcatccctg
ctgaactcagtgcgctccattgcctcgctgctgctgctgctcttcctcttcatcatcatc
ttctccctcctggggatgcagctctttggggggaagttcaactttgatgagatgcagacc
cggaggagcacctttgacaacttcccacagtccctcctcaccgtgtttcagatcctgacc
ggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctctttt
ccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaattatatccta
ctgaacgtgttcttggccattgctgtggacaacctggctgaygcggagagcctcacatct
gcccagaaggaggaggaagaggagaaggagaggaagaagctagccaggaccgccagccca
gagaagaagcaagaggtggtagagaagccggccgtggaggagaccaaggaggagaaaatc
gagctgaaatccatcacggcagatggagagtccccacccgccaccaagatcaacatggat
gacctccagcccaacgagaatgaggacaagagctcctaccccaaccaggaaaccacagra
gaagaggacgaggaggagcccgagatgcccgtgggcccccgcccgcgccccctctctgag
ctgcacctgaaggagaaggcagtgcccatgccggaagccagcgccttcttcatcttcagc
cccagcaacaggttccgcctccagtgccatcgcatcgtcaatgactccatcttcaccaac
ctgatcctcttcttcatcctgctcagcagcatctccctggccgccgaggaccccgtgcag
cacacctccttcaggaaccacattctgttttattttgacattgttttcactaccattttc
accattgagattgccctgaagatgacggcctacggggccttcctgcacaagggctccttc
tgccgcaactacttcaacatcctggacctgctggtggtcagtgtgtccctcatctccttc
ggcatccagtccagtgccatcaacgtggtgaagatcctgcgagtcctgagggtgctccgg
ccactgagggccatcaacagggccaaggggctgaagcacgtcgtgcagtgcgtgttcgtg
gccatccgcaccatcgggaacattgtgatcgtcaccacgctgctccagttcatgttcgcc
tgcattggggtccagctcttcaagggaaagctctacacctgttcggacagttccaaacag
acagaggctgaatgcaaggggaactacataacatacaaggatggggaggtggaccacccc
atcatccagccccgcagctgggagaacagcaagtttgactttgacaatgtcctggcagcc
atgatggccctgttcaccgtctccaccttcgagggatggccagagttgctgtaccgctcc
atcgactctcacacggaggacaagggtcccatatacaactaccgcgtggagatctccgtc
ttcttcatcatctacatcatcatcattgccttcttcatgatgaacatcttcgtgggtttc
gtcatcgtcaccttccaggagcagggggagcaggaatacaagaactgcgagctggacaag
aaccagcggcagtgtgtggagtatgccctcaaggcccggcccctgcggaggtacatcccg
aaaaaccagcaccagtacaaggtgtggtacgtggtcaactccacctacttcgagtacctg
atgttcgttctcattctgctcaacaccayctgcctggscatgcagcactacggtcagagc
tgtctgttcaaaatcgccatgaacatcctcaacatgctcttcaccggcctcttcacagtg
gagatggtsctgaagctcatcgccttcaagcccaagggctactttagtgacccctggaat
gtctttgacttcctgatcgtaattggcagcgtaattgacgtcattctcagtgagacgaat
cactatttctgtgatgcatggaacacatttgacgccttgattgttgtgggtagcattgtt
gatatagccatcaccgaggtaaacccagctgaacatacccaatgctctccctttatgaac
gcggaagagaactctcgcatctccatcaccttcttccgcctcttccgggtcatgcgtctg
gtcaagctgctgagccgcggggagggcatccggacactgctgtggaccttcatcaagtcc
ttccaggccctaccctatgtggccctcctgatcgtgatgctgtttttcatctacgccgtg
atcgggatgcaggtgtttggcaaaattgccctgaatgacacgacagagatcaacaggaac
aacaacttccagaccttcccccaggcsgtgctgctcctcttcaggtgcgccactggggag
gcctggcaggacatcatgctggcctgcatgcctggcaagaagtgygcccccgagtcagag
ccgggcaacagcacagagggggagacgccctgtggcagcagcttcgccgtcttctacttc
atcagcttctacatgctctgygccttcctgatcatcaacctcttcgtagccgtcatcatg
gacaactttgactacctgacgagggactggtccatcctgggtccccaccacctggacgaa
tttaagagaatttgggcagagtatgaccctgaagccaagggacgcatcaaacacctggat
gtggtgaccctgctccgacggattcagccccccctgggttttgggaagctgtgccctcac
cgcgtggcttgcaaacgcctggtctccatgaacatgcccctgaacagcgacgggactgtc
atgttcaatgccacgctgtttgccctggtccgtacagctctgaggatcaagacggaaggg
aacctggaacaggccaatgaggagctgcgggccatcatcaagaagatctggaaacggacc
agcatgaagctgctggaccaagtggtgccgcccgcaggagatgacgaggtcacggtgggc
aagttttacgctactttcctgatccaggagtatttccggaagttcaagaagcgcaaagag
caaggcctggtgggcaagccctcccagaggaacgccctgtccctgcaggctggcctgcgc
accctacacgactccaaaccactcctcagacgctannnntctggtcagctgggtgctgcc
cagcgcggttgagctccctccctaccccgcgggccagccccttcacccaccgccctctct
gtctctcttctcccgcagagggccggcggcctgttcggcaaccacgtgggctactacccg
agcgacggccggggcgccttcccccagaccttcaccacccagcgccccctgcacatcagc
aaggcaggcaacagccagggggacaccgagtccycctcccacgagaaactggtggactcc
accttcacccccagcagctactcatccacgggctccaacgccaacatcaacaacgccaac
aacaccgccctgggccgctgcccccgccccgctctccactccggtgctgtcagcaccttg
gaggcccacgggccccccttgtcccctgccatccgggtgcaggaggccgcgtggaggcac
agctcccagaggtgcccctcccgggacagcccgatagccatgctgtgtcaggaagaggcc
tctggggacgagacctgtgccgtgcacgtggacgagaacgcagagcacagcagcgagccc
agcttggtctccacggagatgctctcctaccaggatgacgagaatcggcagctgactccc
cccgaggaggacaggagggacatccgtctgtccccaaagaggggcttcctgcgctccgcc
tccctaggtcgaagggcctccttccaccttgaatgtctgaagcgacagaagaatcctggg
ggagacgtctctcagaacacagtcctgcctttgcacctggttcaccatcaggcgctggca
gtggcgggtctgagccccctcctgcagagaagccatccccctgggaccctccccccacca
cgcctcacaccccccgccacacctggcccagcctggcctccgcggcctgtgcccaccctg
cggctggaaggggccgagtccagcgacaagctcaccagcagcttcccatccatccactgc
gacccccacatcggggagcccacgccctgcggggttgtcggcaccccccggagggcccgg
cccgtgtcactcactgtgcccagcccggcagggccccagggccgtccgttccatggcagt
gccagcagcctggtggaggcggtcttgatctcggaaggattggggcagtttgctcaggac
cccaggttcctcgaggccaccacgcaggagctggccgatgcctgcgacatgaccattgag
gagatggagagcgcggctgacgacatcctcagcgggggcgccgggcagagccccaacggc
accctgctcccgtgtgcaaactgcagggacccggggccggaccgagcggggggtgtggag
gacgcagcctgggcgcccagcgccgagccccgccagggcgcagaggagccccgggacagc
agggccttcgccagcggcctgtag

DBGET integrated database retrieval system