KEGG   Bos indicus (zebu cattle): 109558630
Entry
109558630         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor subunit B-like
  KO
K17386  platelet-derived growth factor subunit B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04072  Phospholipase D signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05211  Renal cell carcinoma
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05231  Choline metabolism in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109558630
   04014 Ras signaling pathway
    109558630
   04015 Rap1 signaling pathway
    109558630
   04630 JAK-STAT signaling pathway
    109558630
   04020 Calcium signaling pathway
    109558630
   04072 Phospholipase D signaling pathway
    109558630
   04151 PI3K-Akt signaling pathway
    109558630
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109558630
   04540 Gap junction
    109558630
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109558630
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558630
   05206 MicroRNAs in cancer
    109558630
   05231 Choline metabolism in cancer
    109558630
  09162 Cancer: specific types
   05214 Glioma
    109558630
   05218 Melanoma
    109558630
   05211 Renal cell carcinoma
    109558630
   05215 Prostate cancer
    109558630
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109558630
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109558630
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109558630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109558630
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109558630
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109558630
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109558630
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 109558630
NCBI-ProteinID: XP_019815537
UniProt: A0A6P5BM60
LinkDB
Position
5
AA seq 242 aa
MCHSYRSPFALKPEPCNKKSYLNEKPPSHNGFRLPLLEREMPSRHADDTEPPPTDEDGAE
LDLNLTRSHSGCELESLSRGRRSLGSPTVAAEPAVIAECKTRTEVFEISRRLIDRTNANF
LVWPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLAC
RCETVVARAVTRTPGSSQEQRARTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETL
GA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtgccacagctaccgaagcccattcgccctaaagcctgagccctgcaacaagaaaagc
tacctcaatgagaagccccccagccacaacggcttccggctgccattgctagagagagag
atgccttcaaggcatgctgatgacaccgagcctcctcctacagatgaagacggggctgaa
ttggacctgaatttgacccggtcccattctggctgcgagctcgagagcttatcccgtggg
agaaggagcctaggttccccgacggtcgccgcagagccagccgtgattgcggagtgcaag
acgcgcacggaggtgtttgagatctcgcggcgcctcatagaccgcaccaatgctaacttc
ctggtgtggccaccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaac
gtgcagtgccgccccacgcaggtgcaggatcggaaggtgcaggtgaaaaagattgagatc
gtgcggaagaagaagatctttaagaaggccaccgtcaccttggtggaccacctggcgtgc
aggtgtgagacggtggtggctcgagccgtgacccgaaccccggggagttcccaggagcag
cgagccaggacaccccaaactcgggtaaccattcggacggtgcgagtccgccggcccccc
aaggggaagcaccggaagttcaagcacacgcatgacaagacggcactgaaggagaccctc
ggagcctag

KEGG   Bos indicus (zebu cattle): 109559825
Entry
109559825         CDS       T04792                                 

Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04072  Phospholipase D signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05211  Renal cell carcinoma
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05231  Choline metabolism in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109559825
   04014 Ras signaling pathway
    109559825
   04015 Rap1 signaling pathway
    109559825
   04630 JAK-STAT signaling pathway
    109559825
   04020 Calcium signaling pathway
    109559825
   04072 Phospholipase D signaling pathway
    109559825
   04151 PI3K-Akt signaling pathway
    109559825
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109559825
   04540 Gap junction
    109559825
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109559825
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559825
   05206 MicroRNAs in cancer
    109559825
   05231 Choline metabolism in cancer
    109559825
  09162 Cancer: specific types
   05214 Glioma
    109559825
   05218 Melanoma
    109559825
   05211 Renal cell carcinoma
    109559825
   05215 Prostate cancer
    109559825
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109559825
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559825
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109559825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109559825
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109559825
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109559825
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109559825
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 109559825
NCBI-ProteinID: XP_019817386
UniProt: A0A6P5BVV9
LinkDB
Position
5
AA seq 242 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYKMLSDHSIRSFDDLQRLLHGDSVDEDGAEL
DLNLTRSHSGGELESLSRGRRSLGSPTVAAEPAVIAECKTRTEVFEISRRLIDRTNANFL
VWPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLACR
CXXXXXRAVTRTPGSSQEQRAARTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETL
GA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggagaccccattcccgaggagctctacaagatgctgagtgaccactccatccgttcc
ttygatgacctccagcgcctgctgcatggagactccgtagatgaagacggggctgaattg
gacctgaatttgacccggtcccattctggaggcgagctcgagagcttatcccgtgggaga
aggagcctaggttccccgacggtcgccgcagagccagccgtgattgcggagtgcaagacg
cgcacggaggtgtttgagatctcgcggcgcctcatagaccgcaccaatgctaacttcctg
gtgtggccaccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtg
cagtgccgccccacgcaggtgcaggatcggaaggtgcaggtgaaaaagattgagatcgtg
cggaagaagaagatctttaagaaggccaccgtcaccttggtggaccacctggcgtgcagg
tgtgnnnnnnnnnnnnctcgagccgtgacccgaaccccggggagttcccaggagcagcga
gcagccaggacaccccaaactcgggtaaccattcggacggtgcgagtccgccggcccccc
aaggggaagcaccggaagttcaagcacacgcatgacaagacggcactgaaggagaccctc
ggagcctag

KEGG   Bos indicus (zebu cattle): 109559983
Entry
109559983         CDS       T04792                                 

Gene name
EGF
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04072  Phospholipase D signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05160  Hepatitis C
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05226  Gastric cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109559983 (EGF)
   04012 ErbB signaling pathway
    109559983 (EGF)
   04014 Ras signaling pathway
    109559983 (EGF)
   04015 Rap1 signaling pathway
    109559983 (EGF)
   04630 JAK-STAT signaling pathway
    109559983 (EGF)
   04066 HIF-1 signaling pathway
    109559983 (EGF)
   04068 FoxO signaling pathway
    109559983 (EGF)
   04020 Calcium signaling pathway
    109559983 (EGF)
   04072 Phospholipase D signaling pathway
    109559983 (EGF)
   04151 PI3K-Akt signaling pathway
    109559983 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109559983 (EGF)
   04540 Gap junction
    109559983 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109559983 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559983 (EGF)
   05231 Choline metabolism in cancer
    109559983 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109559983 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109559983 (EGF)
   05212 Pancreatic cancer
    109559983 (EGF)
   05226 Gastric cancer
    109559983 (EGF)
   05214 Glioma
    109559983 (EGF)
   05218 Melanoma
    109559983 (EGF)
   05219 Bladder cancer
    109559983 (EGF)
   05215 Prostate cancer
    109559983 (EGF)
   05213 Endometrial cancer
    109559983 (EGF)
   05224 Breast cancer
    109559983 (EGF)
   05223 Non-small cell lung cancer
    109559983 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109559983 (EGF)
   05165 Human papillomavirus infection
    109559983 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109559983 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109559983 (EGF)
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109559983 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3
Other DBs
NCBI-GeneID: 109559983
NCBI-ProteinID: XP_019817581
UniProt: A0A6P5BWE1
LinkDB
Position
6
AA seq 1201 aa
MLHFLVIVLLVVFKFSFVSLSALPHLNCPEGSPSGNGNSTCAGLVPFLIFSHGNSICRID
LEGMNYEQLVADAGISVIMDFHYNEERIYCVDLXRQLLQRVHLNGRRQEXVYDIDKNVSG
MAINWINEELIWSNQQEGIITVTDRKGNNSWVLLSALKYPANIAVDPVASFMFWSSEVAX
SLHRADLGGMEVKLLLETSEKIAAVSLDMLDKRLFWIQYHRGGGDPRICSCDYDGGSVLF
SKYSLRHNLLAESFFGDCIFYSTWKKKTIWIANKHTGKDMVKITLNSSFVPPSGIKVVRP
LVXPKAEGDAWASDVSECAFRNHGYTDDCENIPGSYYCTCPEGYVLLPDGKWCHQLISCP
RNVSKCSHDCVLTSDRPICSCPEGSVLDTDGKTCSGCSSPDNGGCSQPCTPLSPVSWKCG
CLPGYDLQLDKKSHRPSGPPPFLLFASSQDIRYMHFDGTDYGTLVYQQIIGMVFALDHDP
VENKTVCLCSLLLIYFAHTVLKWIERANMDASQRXRLIEEEVGLPEGLAVDWIGHKLYWT
DRGKSLIEGSDLNGKYCEIIIKEGISQPRGXAVHPMAKRLFWTDIGINPRIESSSLQGSG
RLVIASSDLVWHSGIAVDYLTDKLYWCDAKQSVIEMSNLDGSKCQRLPQKDVGHPFAVAV
FEDHVWFSDWTMPSITRMNKRTGKNSVRLPGSMLKPSSLLVVHPLAKPGADPCLHQNGGC
EHICKERFETAQCLCHEGFVKAPDGKMCLALHGHRILSDNMTNCSGANLSSEVLPLDILA
GSRELDYNMAESQHLPVAEIMVSDLLRACKQKHMACGPFDIDTDYRSTWCFCLEVNLSQN
LTKEVLECSIIKTDAMGCSTRAECLSKGADVTCQCLKGFAGDGKQCSDVDGCEMGLSVCP
PTSPKCVNTEGGYVCWRSESYQGDGIHCLDIDECRRGVHSCGENATXXNMEGNHTCTCAG
DLSEPGQICPDSTLLSHLGKNGHNFLKKCFPEYTPNFEGYCLNGXVCIYFGIANLFSCHC
PIGYPGKRGEYIDFDGWDPHSAGRGHQWNTSPVAVRALVLAFLLLLGLCRAHYYYRTQKW
LLKNPKNPCEEPSRDVIRSRPADGEAGXPFCPQPWFVVVKEHQNLRNGRPSEALKEGLAA
DVGQFSPLDPASLEQSSWRAEPQMYTGAEHGGCIASSNDRGSAHPLWQQRSSHQMELTLK
T
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgctgcatttccttgtcattgtgttgctggtagttttcaaatttagttttgttagcctc
tcagccctgccgcacttgaactgtcctgaaggctctccctctggaaatgggaattctact
tgtgcaggtcttgtgccctttttaattttttcccatggaaatagtatctgtaggattgat
ttggaaggaatgaattatgaacaattggtggcagatgctggcatatcagtgatcatggat
tttcattacaatgaagaaagaatctattgcgttgatctanncagacaactcttgcaaaga
gttcatttgaatgggagaaggcaagagraagtatatgatatagataaaaatgtttcagga
atggcaataaattggatcaatgaagaacttatttggtctaatcaacaggaaggaatcatt
acagtaactgataggaaaggaaacaattcctgggttctcttaagtgccttaaaatatcct
gcaaatatagcagttgatccagtagcaagttttatgttttggtcttcagaggtggctngc
agccttcacagagcagatcttggtggtatggaagtcaagcttctgttagagacatcagag
aaaatagcagctgtatcattggatatgcttgataaacggctcttttggattcagtaccat
agaggaggaggtgatcctcgtatttgttcctgtgattatgacgggggttctgtccttttt
agcaaatattccctgaggcacaatctgcttgcagagtccttctttggagattgtatcttc
tattcaacatggaaaaagaagacaatttggatagctaacaagcacacagggaaggatatg
gttaaaatcaccctcaactcgtcattcgtgccacccagtggaattaaagtggttcgtcca
ctcgtatagcccaaggcagagggtgatgcttgggcatctgatgtcagtgagtgtgctttt
cggaatcatggctacacagatgactgtgaaaatatccctggatcctattactgcacatgc
cctgagggatatgtcctgcttcctgatgggaaatggtgtcaccagttaatttcctgccca
agaaatgtgtctaaatgcagtcatgactgtgttctgacatcagaccgtcccatatgttcc
tgtcctgaaggctcagtgcttgacacagatggaaagacatgcagtggctgttcatcacct
gataatgggggatgtagccagccctgcacccctctcagccccgtatcctggaaatgtggc
tgccttcctgggtatgacctacaactggacaaaaagagccatagaccttcaggaccacca
ccatttttgctgtttgccagttctcaagacattcgatacatgcattttgatggaacagat
tatggaaccctggtctaccaacaaataataggaatggtttttgcccttgatcatgaccct
gtggaaaataagactgtatgcctgtgttctcttttgttgatatactttgcccatacagtc
ctgaagtggatagaaagagctaatatggatgcttcccagcgangaaggcttatcgaggaa
gaagtaggtttaccagaaggtcttgctgttgactggattggccataaactctactggaca
gacagagggaaatctctcattgaagggagtgatttaaatggaaagtattgtgaaataatc
attaaggagggcatctctcagccacgagganatgctgttcatccaatggccaagagatta
ttctggactgatataggaattaatccacgaattgaaagttcttctcttcaaggcagtggc
cgactggttatagctagctcggatctagtctggcacagtggaatagcagttgattactta
actgacaagttgtattggtgcgatgccaagcagtctgtgattgaaatgtccaatctggat
ggctcaaaatgccaaagacttccccagaaggatgtaggtcacccatttgccgtggctgtg
tttgaggatcacgtgtggttctctgattggactatgccatcgataacaaggatgaacaag
aggactggcaaaaatagcgtacgtctcccaggcagcatgctgaagccctcatctctgctt
gtagttcatccattggcaaaaccaggagcagatccctgcttacatcaaaatggaggctgt
gaacatatttgcaaagagaggtttgaaactgctcagtgtttgtgtcatgaaggttttgtg
aaagctccagatggaaaaatgtgtctggctcttcatggccatcggatattgtcagataat
atgacaaactgtagtggagccaatctgagtagtgaagtcctgccactggacatcttagcc
ggcagcagagagcttgactataacatggcagagtctcaacacctgccagtggccgagatc
atggtgtcagatttgttgagagcatgtaaacagaagcatatggcttgtggaccctttgat
atagatacagattacagatcaacatggtgtttctgtttggaggttaacctgtcccagaac
ttgacaaaagaagttctagaatgttctataataaagactgatgccatgggatgcagtaca
cgggctgagtgcctttcaaagggagcagatgtcacatgtcagtgtttgaaaggatttgct
ggagatggaaaacaatgttctgatgtagatggatgtgagatgggtctctcagtttgccct
cccacctcccccaagtgtgtcaatacagaaggtggctatgtctgctggcgctcagagagc
taccagggagatggaatccactgtttggatattgatgagtgccgacggggcgtgcacagc
tgtggggaaaatgccacctgaamaaatatggagggaaaccacacttgcacgtgtgctggc
gacttgtctgagcctggacagatttgccctgactctactctgctgtctcaccttgggaag
aatggacacaattttttgaaaaaatgtttccctgaatataccccgaattttgaagggtac
tgcctcaatggtcrtgtctgtatatattttggcattgccaacctgttctcctgccactgt
cccattggctaccctgggaagcgaggtgagtacatagacttcgatgggtgggatccgcac
agtgcaggccgtgggcatcagtggaacaccagcccggtggctgtccgtgcgctggtgctg
gctttcctgctgctcctcgggctgtgcagagctcactactactacaggactcagaagtgg
ctactgaaaaatccaaagaatccttgtgaagaaccgagcagagatgtgatccgtagcagg
cctgcagatggcgaggctggantgcctttttgcccccaaccttggttygtggttgtaaag
gaacatcaaaacctcaggaatgggcgtccatccgaggccctcaaggaaggcctggcagca
gatgttggccagttttcccccctggatcctgcgtccttggaacagtcatcatggagagcg
gagccccagatgtatacgggcgcagaacacggaggctgtattgcgtcatccaacgataga
ggctctgctcaccctttgtggcaacaaagatcatcacaccaaatggagctgactctgaaa
acttga

KEGG   Bos indicus (zebu cattle): 109578611
Entry
109578611         CDS       T04792                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04072  Phospholipase D signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05231  Choline metabolism in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109578611 (PDGFA)
   04014 Ras signaling pathway
    109578611 (PDGFA)
   04015 Rap1 signaling pathway
    109578611 (PDGFA)
   04630 JAK-STAT signaling pathway
    109578611 (PDGFA)
   04020 Calcium signaling pathway
    109578611 (PDGFA)
   04072 Phospholipase D signaling pathway
    109578611 (PDGFA)
   04151 PI3K-Akt signaling pathway
    109578611 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109578611 (PDGFA)
   04540 Gap junction
    109578611 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109578611 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578611 (PDGFA)
   05202 Transcriptional misregulation in cancer
    109578611 (PDGFA)
   05206 MicroRNAs in cancer
    109578611 (PDGFA)
   05231 Choline metabolism in cancer
    109578611 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    109578611 (PDGFA)
   05218 Melanoma
    109578611 (PDGFA)
   05215 Prostate cancer
    109578611 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109578611 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109578611 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109578611 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109578611 (PDGFA)
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109578611 (PDGFA)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109578611 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 109578611
NCBI-ProteinID: XP_019843552
UniProt: A0A6P5E2U7
LinkDB
Position
25
AA seq 219 aa
MLISLLDQQLPGPLATPRPVTDTPGQRGPEAEIPREVIERLAHSQIHSIRDLQRLLEIDS
VGAEEPLETSLRAHGGHXAKHALEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDP
TSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRNVKVAKVEYFRKKAKLKEVQVRLE
EHLECTCTSASPSPDHREEEAGRRRESGKKRKRKRLKPT
NT seq 660 nt   +upstreamnt  +downstreamnt
atgttgatttcactattagaccagcagctccccgggcccctcgccacccctagacctgta
acggacacccctgggcagaggggccccgaagccgagatcccccgcgaggtcattgagagg
ctggcgcacagtcagatccacagcatccgggacctccagcgactcctggagatagactcc
gtaggagctgaggagcctttggaaaccagtctgagagcccacgggggccacrgcgccaag
catgccctggagaagcggccagtgcccatccggaggaagaggagcatcgaggaggccatc
ccagcggtctgcaagaccaggactgtcatttacgagatacctcggagccaggtggacccc
acgtccgctaacttcctaatctggccgccgtgcgtggaggtgaagcgctgcaccggctgc
tgcaacacgagcagcgtcaagtgccagccgtcgcgtgtccaccaccggaacgtcaaggtg
gccaaggtggagtacttcaggaagaaggcgaagttaaaagaggtgcaggtgcggctggag
gagcacctggagtgcacgtgcacgagcgccagcccgagccccgaccaccgcgaggaggag
gcgggaaggcgtagggagtcaggtaaaaaacggaaaagaaaaaggttaaaacccacctaa

DBGET integrated database retrieval system