KEGG   Bos indicus (zebu cattle): 109558981
Entry
109558981         CDS       T04792                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
biu04910  Insulin signaling pathway
biu04917  Prolactin signaling pathway
biu04930  Type II diabetes mellitus
biu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109558981 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109558981 (SOCS2)
   04917 Prolactin signaling pathway
    109558981 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    109558981 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109558981 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109558981 (SOCS2)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109558981 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 109558981
NCBI-ProteinID: XP_019815911
UniProt: A0A6P5BMV5
LinkDB
Position
5
AA seq 198 aa
MTLRCLESSGNGAEGAQSQWGTAGSAEEPSPEAARLAKALRELSHTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTSTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagtcctccgggaatggcgcggaaggggcgcagagccagtgg
gggaccgcggggtcggcggaggagccgtccccagaggcggcgcgtctggcgaaggccctg
cgggaactcagtcacacaggttggtactggggaagtatgactgttaatgaagccaaagag
aagttaaaagaggcaccagaaggaactttcttgattagagatagttcgcattcagactac
ctactaacaatatctgttaagacatcagctggaccaactaatcttcgcatcgaataccaa
gatgggaaatttagattggaytctatcatatgtgtcaagtccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggccca
gaagccccccggaacggcactgttcacctttatctgaccaagccactctacacatcagca
ccacccctgcagcatctctgtagactcaccattaacaagtgtaccagcaccatctgggga
ctgcctttaccaacaagactaaaagattatttggaagaatataaattccaggtataa

KEGG   Bos indicus (zebu cattle): 109565183
Entry
109565183         CDS       T04792                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
biu04910  Insulin signaling pathway
biu04917  Prolactin signaling pathway
biu04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109565183 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109565183 (SOCS4)
   04917 Prolactin signaling pathway
    109565183 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109565183 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109565183 (SOCS4)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109565183 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 109565183
NCBI-ProteinID: XP_019824514
UniProt: A0A6P5CGQ2
LinkDB
Position
10
AA seq 440 aa
MAENSESNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVSAIEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPISPKSDEWVSTDLSQSELRDGQLKQRR
NMEEVSCFSHTSVQPCVITSNNSSGRGGPGTDSIVNLASNNSIEDSDMDSDDEIITLCTS
SRKRNKPKWEIDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaatagtgaaagtaatagtaaaaatgtagatgtaaggcccaaaactagccgg
agtcgaagtgctgacagaaaggatggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgaaagttgttcagatgctgaaacagtgagtgctatcgagaaaactgaagtt
cctttaaggagccaagaaaggaagcacagctgttcatctatcgagttggatttagatcat
tcctgtgggcatagatttttaggccgatctcttaaacagaaactgcaagatgctgtgggg
cagtgttttccaataaagaattgtagtagtcggcattcttcagggcttccatctaaaaga
aaaattcatatcagtgaactcatgttagataagtgtccgttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataagtcccaaatcagatgaa
tgggtaagcacagacttgtctcagagcgaattgagggatggtcagctaaaacaacgaaga
aacatggaagaggtcagctgcttctcacataccagtgttcagccctgtgtcataaccagt
aacaattcttcgggtagaggtggtcctgggactgactctatagtgaacctggcttcaaat
aacagcatagaagatagtgacatggattcagatgatgaaattataacactttgcacaagt
tcccggaaaagaaacaaacccaaatgggaaattgatgaagaaatcctgcaactggaaaca
cctcccaagtaccatactcagattgattatgtccactgtcttgtaccagacctccttcag
atcaataataatccatgttactggggtgttatggataaatatgcagctgaagctctacta
gaaggaaaaccagaaggcacctttttactgcgagattcagcacaggaagactatttattc
tctgttagttttagacgctatagtcgttctcttcacgctagaattgaacagtggaatcac
aactttagctttgatgcacatgatccttgtgtcttccattcgcctgacattactgggctc
ctagagcattacaaggacccgagtgcctgtatgttcttcgaaccacttttatccactcct
ttaattcggactttccccttttccctgcagcatatatgcagaacagttatttgtaactgt
acaacttacgatggcattgatgcccttccaattccttcttccatgaaattatatctgaag
gaatatcactataaatcaaaagttagagtactcaggattgatgcaccagaacaacaatgc
tag

KEGG   Bos indicus (zebu cattle): 109566051
Entry
109566051         CDS       T04792                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109566051 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109566051 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109566051 (SOCS5)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109566051 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 109566051
NCBI-ProteinID: XP_019825662
UniProt: A0A6P5CL94
LinkDB
Position
11
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISLGDSAPQQQSSPLR
ENVALQLGLSPSKNSSRRNQNCAAEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWXLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEVNGDSSAVPQANCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaagtacaggtgtcagaatctctttggt
cacgagggaggaagccgtagtgaaaatgtggatatgaactccaacagatgtttgtctgtc
aaagagaaaaacatcagtttaggagactcagctcctcagcagcaaagcagtcccttaaga
gaaaacgttgccttacaactagggttaagcccttcaaagaattcttcaaggagaaaccaa
aactgtgccgctgaaattcctcagattgttgaaataagcattgaaaaggataatgactca
tgtgtcaccccaggaacaagacttgcaagaagagattcctactctcgacatgctccttgg
ggtgggaagaagaaacattcctgttctacaaagacacagagttcactggatacggataaa
aagtttggtagaactcgaagtggacttcaaaggagagagcggcggtacggcgtcagctcc
gtgcacgacatggacagtgtgtccagcaggactgtaggaagtcgctctctgagacagagg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaaaccc
ctattttctaataaaagaaaaatacatctttctgaattaatgcttgagaaatgccctttt
cctgctggctcagatttggcccaaaaatggcrtttgattaagcagcacacagcccctgtg
agcccacattcaacattttttgatacatttgatccatccttggtttctacagaagatgaa
gaagatcggcttcgagagagaaggcggcttagtattgaagaaggggtagaccccccgccc
aaygcacaaatacatacattcgaagccactgcacaggttaacccgttatataaactggga
ccaaagttagctcctggaatgactgaagtaaatggggacagttctgcagttccacaagct
aattgtgactcagaagaggacacaaccacgctgtgtttgcagtcacggaggcagaagcaa
cgtcaggtgtctggagacagccatgcccacgttagcagacagggagcctggaaagtccac
acgcagattgattacatacactgcctygtgccggacttgctccagatcacaggtaatccc
tgttactggggagtgatggaccgctacgaagcagaagcccttctggaagggaaacctgaa
ggtacatttttgctcagggactctgcacaagaggactacctcttctctgtgagcttccgt
cgctacaacaggtccctgcatgcccgaattgaacagtggaatcacaactttagtttcgat
gcccatgacccatgtgtgtttcactcctccactgtaacaggacttttggaacactacaaa
gaccccagctcttgcatgttttttgaaccattgcttacaatatcactaaacaggactttc
ccttttagcctgcagtacatctgccgtgcagtcatctgcagatgcacgacgtatgatgga
attgatgggctccctttaccatcratgttacaggattttttaaaagagtatcattataaa
cagaaagttagagttcgctggctagaacgagaaccagtcaaagcaaagtaa

KEGG   Bos indicus (zebu cattle): 109573815
Entry
109573815         CDS       T04792                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7 isoform X1
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109573815 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109573815 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109573815 (SOCS7)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109573815 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 109573815
NCBI-ProteinID: XP_019836835
UniProt: A0A6P5DHH4
LinkDB
Position
19
AA seq 642 aa
MQGAELRDGEAAAAAASYRVLSRLLGYGEAAPEPGPPPPPPGHGPAPPPFLARPGPRGSR
PPQLMVFRNVGRPPEEEDAEAAQEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGL
EAQLAALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLV
LEGLESEAESLETNSCSEEELSSPGRGGGGGGRLLLQTPGPELPPVPFPMQDLVPPGRLS
RGEQPQQPPPPPPPPGPLRPLAGLSRKGSLKIRLSRLFRTKSCNGGSGGGDGAGKRPSGE
LAASAASLTDMGGSXGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGL
TSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIA
PIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDG
SFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIM
HSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPL
PKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVLEPST
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgcagggggccgagctccgggatggcgaggcggcggcggcggccgcttcgtaccgcgtc
ctgagccgcctgctcggctatggagaggcggcccccgagccaggcccgccgccgccgccc
ccgggccatggccccgcgccgccacccttcctcgcgcggcccggcccgcggggctccagg
ccgcctcagctgatggtgttccgcaacgtgggtcggccgccggaggaggaggacgcggag
gcggcccaggagccgggaccctcggaactgctctgtccccggcaccgctgtgccctggac
cccaaggccctgccgccggggttggcgctcgagcggacctggggcccggcggctggacta
gaggcgcagttggccgctctggggctcgggcagccggctgggccgggggtcaagacggtc
ggcgggggttgctgcccgtgcccgtgtcccccgcagccgccccctccgcagccccagccg
cctgctgccgccccgcaggccggggaggaccccacggaaacgagcgacgcgctgctggtc
ctggagggcttggagtcggaggcagagagcctggagactaacagctgctcggaagaggag
ctcagcagcccgggccgcggaggaggagggggcggccggcttctactgcagacccccggc
cctgaattacccccggtgcccttcccgatgcaggacttggtccctcccgggcgcttgagt
cgaggggagcagccgcagcagcctcccccgccgccgccgcctcctgggcccctccggcca
ctcgccggcctttctcggaagggctccctcaaaatccgcctcagtcgcctcttccgcacg
aagagctgcaacggtggctctggcggtggggatggggccggcaagaggccttctggagag
ctggctgcttcagctgcgagcctgacagacatgggcggctctrcgggccgggagctggac
gcggggaggaaacccaggttgacaagaactcaaagtgccttttctccagtctccttcagc
ccgctgttcacaggtgaaacagtgtctcttgtggacgtggacatctctcagcggggcctg
acctctccacaccctccaactccccctcctcctccaagaagaagcctcagcctcctagat
gatatcagtgggacgctgcctacatctgtccttgtggctccgatggggtcttccctgcag
tctttccccttacctccgcctcctccaccccatgccccagatgcatttccccggatcgct
cccatccgagcagccgaatctctgcacagccagcccccgcagcacctccagtgtcccctc
taccggcctgactcgagcagctttgcggctagccttcgagagctggagaagtgtggttgg
tattgggggccgatgaattgggaagatgcagagatgaagctgaaaggcaagcctgatggt
tcttttctggtacgagacagctccgatcctcgttatatcctgagcctcagtttccgatca
cagggtatcactcaccacaccagaatggagcactacagaggaaccttcagcctgtggtgt
catcccaagtttgaggatcgctgtcaatcagtggtggagttcattaagagggccatcatg
cactccaagaatgggaagtttctctatttcttgagatccagggttccaggactgccacca
actccagtccagttgctctatccagtgtcccgattcagcaatgtcaaatccctccagcac
ctttgccgattccgaatccgacagctcgtccggatygatcacatcccggatctcccactg
cctaagcctctgatctcttatatccgaaagttctactactatgatcctcaggaagaggta
tacctgtctctaaaggaagcgcagctcatttccaaacagaagcaagaggtgttggaaccc
tccacgtag

KEGG   Bos indicus (zebu cattle): 109574319
Entry
109574319         CDS       T04792                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04120  Ubiquitin mediated proteolysis
biu04380  Osteoclast differentiation
biu04630  JAK-STAT signaling pathway
biu04668  TNF signaling pathway
biu04910  Insulin signaling pathway
biu04917  Prolactin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04935  Growth hormone synthesis, secretion and action
biu05160  Hepatitis C
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109574319 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109574319 (SOCS3)
   04668 TNF signaling pathway
    109574319 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109574319 (SOCS3)
   04920 Adipocytokine signaling pathway
    109574319 (SOCS3)
   04917 Prolactin signaling pathway
    109574319 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    109574319 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109574319 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109574319 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    109574319 (SOCS3)
   04931 Insulin resistance
    109574319 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109574319 (SOCS3)
   05164 Influenza A
    109574319 (SOCS3)
   05168 Herpes simplex virus 1 infection
    109574319 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109574319 (SOCS3)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109574319 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 109574319
NCBI-ProteinID: XP_019837856
UniProt: A0A6P5DI83
LinkDB
Position
19
AA seq 229 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSTVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPAAGAPSFSQPPAEPSSSPSSEVPEQPPAQPLSGNPPRRAYYIYSGGEKIPL
VLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 690 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttttactggagcaccgtgacgggcggcgaagcgaacttgctgctg
agcgccgagcccgcgggcaccttcctcatccgcgacagctcggaccagcgccactttttc
accctcagcgtcaagacccagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctctctccagagcgacccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcatcactacatgcccgccgccggcgccccctcgttctcccagcccccc
gctgaaccctcctcctcgccctcctccgaggtgcccgagcagccaccggcccagccgctc
tccgggaacccccccaggagagcctattacatctactcggggggcgagaagatccctctg
gtgttgagccggcccctctcctccaacgtggccactctccaacatctctgtcggaagacc
gtcaacggccacctggactcctacgagaaagtcacccagctgcctgggcccattcgggag
ttcctggaccagtacgatgccccgctttag

KEGG   Bos indicus (zebu cattle): 109577635
Entry
109577635         CDS       T04792                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109577635 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109577635 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109577635 (SOCS6)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109577635 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 109577635
NCBI-ProteinID: XP_019841966
UniProt: A0A6P5DUM3
LinkDB
Position
24
AA seq 480 aa
MKKISLKTFRKSFNLSKSKEDAEFMVVQQPALAGDFGKEESLFGSCYGKEMAGCELHGED
EKGGGGKNRAKSESLMGTLKRRLSAKQKAKGKGGAAAGGAADEDTFSSSSAPLVFKDARA
PRPMRSTSLRSHHYSPTPWPLRPTASEETCIRMEVRVKALVHSPGTGPALNGVRKDFGEL
RPAAEPACPCPEPPAAPGSPAPVAGDLRLRLGEHVPVVLGLLPQDYLPYTVPLDGSSPMG
GLGRPAAPGPDGPPLSPLLPPLQTDPSQRTFTGLAGPDAHAADSVRCHLNFDPTSAPGVA
RVYDSVQSSGPLAVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDR
YLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRS
RLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaagaagatcagccttaagaccttccggaaatctttcaatttgagtaagagcaaagaa
gacgcagaattcatggtcgtacaacagccagcactagccggcgactttggcaaagaggag
tccttgttcgggagctgctacgggaaggagatggccggctgcgagctgcacggcgaggay
gaaaagggcggcggcggcaagaaccgggccaagagcgagagcctcatgggcacgctgaag
aggcggctgagcgccaagcagaaggccaagggcaaggggggcgcggcggcggggggcgcg
gcggatgaggacaccttctcgtcgtcgtcggcgccgctggtgttcaaggaygcgcgggcg
ccgcggcccatgcgctccacgtcactgcgcagccaccactacagccccacgccctggccg
ctgcggcccaccgcctcggaggagacgtgcatccggatggaggtgcgggtcaaggcgctg
gtgcactcgcccggcacgggcccggctctcaacggcgtgcgcaaggacttcggtgagctc
cgcccggcggccgagcccgcctgcccgtgcccggagccacccgccgcgcccgggagcccg
gcgcctgtggctggggacctgcgcctgcgtctgggcgagcacgtgcctgtggtcctgggc
ctgctgcctcaggactacctcccgtacaccgtgcctttggacggctcctccccgatggga
ggtctcggccgtcccgccgcccccgggcccgacgggccccccctctccccgctgctacct
ccgctgcagaccgatccgagccaaaggaccttcaccgggctggccggcccggatgcccac
gcggccgacagcgtgcgctgccacttgaattttgaccccacctcagctcccggggtggcc
agggtgtacgactcggtgcagagcagcggccccctggcggtgaccagcctgacggaggag
ctcaagaagctggccaagcagggctggtactgggggcccatcacgcgctgggaggcagag
ggcaagctggccaacgtgcccgacggctccttcctggtgcgggacagctcggacgaccgc
tacctgctcagcctgagcttccgctcgcacggcaagaccctgcacacccggatcgagcac
tcgaacggccggttcagcttctacgagcagccggacgtagaggggcacacgtccatcgtg
gacctaatcgagcactccatcagggactcggagaacggcgccttctgctactcgcgctcg
cgcctgccgggctccgccacctacccggtgcggctcaccaacccggtgtcgcgcttcatg
caggtgcgctcgctgcagtacctgtgccgcttcgtcatccgccagtacacccggatagac
ctgatccagaagctgcccctgcccaacaaaatgaaggattacctacaggagaagcactac
tga

KEGG   Bos indicus (zebu cattle): 109578851
Entry
109578851         CDS       T04792                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04120  Ubiquitin mediated proteolysis
biu04380  Osteoclast differentiation
biu04630  JAK-STAT signaling pathway
biu04910  Insulin signaling pathway
biu04917  Prolactin signaling pathway
biu04930  Type II diabetes mellitus
biu04935  Growth hormone synthesis, secretion and action
biu05145  Toxoplasmosis
biu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109578851 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578851 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109578851 (SOCS1)
   04917 Prolactin signaling pathway
    109578851 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    109578851 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109578851 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109578851 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109578851 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109578851 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109578851 (SOCS1)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109578851 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box PBP_N
Other DBs
NCBI-GeneID: 109578851
NCBI-ProteinID: XP_019843927
UniProt: A0A6P5E3Q9
LinkDB
Position
25
AA seq 223 aa
MVAHNQVAADNAISTAAEPRRRPESSSSSSSSSSSTSSPSSXAPAXLRPCPAAAAPAPAP
APGDTHFRTFRSHAEYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQ
RNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQ
RRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 672 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcaatctccacggcagcagagcccmga
cggcggccagagtcttcttcctcctcctcctcctcctcctcttccacctcctcgccctcg
tccrcggccccggcgcnnctgcggccctgcccggcggccgcagccccggctccagccccg
gccccgggcgatacgcacttccgcacgttccgctcgcacgccgagtaccggcgcatcacy
cgagccagcgcgctcctcgacgcctgcggcttctactgggggcccctgagcgtgcacgga
gcgcacgagcggctgcgcgccgagcccgtgggcaccttcctggtgcgcgacagccgacag
aggaactgcttcttcgccctcagcgtgaagatggcctcgggccccacgagcatccgcgtg
cacttccaggccggccgcttccacctggacggcagccgcgagagcttcgactgcctcttc
gagctgctggagcactacgtggcggcgccgcgccgcatgctgggggccccgctgcgccag
cgccgcgtgcggccgctgcaggagctgtgccgccagcgcatcgtggccaccgtgggccgc
gagaacctggcgcgcatccccctcaaccccgtcctccgcgactacctgagctccttcccc
ttccagatctga

DBGET integrated database retrieval system