KEGG   Bos indicus (zebu cattle): 109559100
Entry
109559100         CDS       T04792                                 

Gene name
MME
Definition
(RefSeq) neprilysin
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04614  Renin-angiotensin system
biu04640  Hematopoietic cell lineage
biu04974  Protein digestion and absorption
biu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109559100 (MME)
  09152 Endocrine system
   04614 Renin-angiotensin system
    109559100 (MME)
  09154 Digestive system
   04974 Protein digestion and absorption
    109559100 (MME)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559100 (MME)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     109559100 (MME)
Peptidases and inhibitors [BR:biu01002]
 Metallo peptidases
  Family M13: neprilysin family
   109559100 (MME)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109559100 (MME)
CD molecules [BR:biu04090]
 Proteins
  109559100 (MME)
SSDB
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Other DBs
NCBI-GeneID: 109559100
NCBI-ProteinID: XP_019816134
UniProt: A0A6P5BSQ8
LinkDB
Position
1
AA seq 750 aa
MGRSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
ECIKSAARLIQNMDATVEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVVLKD
VLQEPKTEDIIAVQKAKMLYRSCINETAIESRGGEPLLRLLPDIYDWPVALENWEQKYGS
SWTAEKSIAQLNSKYGKKVIINFFVGTDDKNSTNHIIHIDQPQLGLPSRDYYECTAAYKE
ACTAYVDFMISVAKLIRQERGLPIDENQLSLEMNKVMDLEKEIANATTKSEDRNDPMLLY
NKMTLAEVQNKFSLEFSGKPFSWSNFTNEIMSTVNINIPHEEEVIVYAPEYLTNLKLILA
KYSARDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFPGDSKHVVEDLIAQIRAVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNDDKLNKEYLELSYQEEEYFENIIQNLKFGQNRQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQPKSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKDLSQCMVYQYGNFSWDLANGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKHGEEKLLPGLDLNHRQLFFLNFAQVWCGTYRTEYALNSIKTDVHSPGNFRII
GTLQNSPQFSEAFHCRKNSYMNPEKKCRVW
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgggcagatcagaaagtcagatggatataactgatatcaacacaccaaagccaaagaag
aaacagagatggaccccaytggagatcagcctctccgtcctcgtcctgctgctcaccatc
attgcagtgacaatgatagctctctatgcaacctatgatgatggtatttgcaagtcatca
gagtgcataaaatcagccgctcgactgatycagaacatggatgccactgttgagccttgt
acagactttttcaaatatgcttgcggaggctggttgaaacgtaacgtcattccggaracc
agctctcgttacagtaactttgacattttaagagatgaattagaagtcgttttgaaagat
gtccttcaggaacccaaaactgaagatataatagcagtgcagaaagcaaaaatgttatat
agatcttgtataaatgaaactgctattgagagcagaggcggggaacctctacttagactg
ttgccagatatatatgattggccagtggcrctagaaaactgggagcaaaaatatggttct
tcttggacagctgagaaatctattgcacaactgaattctaaatatggaaaaaaagtcatt
attaatttttttgttggcactgatgataaaaactctacgaatcatataattcatattgac
caacctcaacttggcctgccttccagagactactatgaatgcactgcagcatataaagag
gcttgtacggcatatgtggattttatgatttctgtggccaaattgattcgtcaggaaaga
ggactgcccatagatgaaaaccagctttctttggaaatgaataaagttatggatttggaa
aaagaaattgccaatgctacaactaaatctgaagatcgaaatgatccaatgcttctttat
aacaaaatgacattagctgaggtccaaaataaattttcactggaattcagtgggaagcca
ttcagctggtcaaatttcacaaatgaaatcatgtcaaccgtgaatatcaatattccacat
gaggaagaagtgattgtttatgctccagaatatttaaccaatcttaagctcattcttgcc
aaatattctgccagagatcttcaaaatttaatgtcctggcggttcataatggatcttgta
agcagcctcagccgaaactacaaggagtccagaaatgctttccgcaaggctctttatggc
acaacatcagaaacagcaacttggaggcgctgcgcaaactatgtcaatgggaatatggaa
aatgccgtgggaaggctctatgtggaagcggcatttcctggagatagtaaacatgtggtt
gaggatttaattgcccagatccgggcggtttttattcaaactttagatgacctaacttgg
atggatgctgaaacaaaaaagaaagctgaagaaaaggccttagcaattaaagaaagaatt
ggctatcctgatgacattatttcaaatgatgacaaattgaataaagagtaccttgagttg
agctaccaggaagaagaatactttgagaatataattcaaaacttgaagtttggccaaaat
agacaactaaagaagcttcgagaaaaggtggacaaggatgagtggataagcggagcagct
gtagtcaatgcattttactcgtcaggcagaaatcagatagtcttcccagctggcattctg
cagccaccctttttcagtgcccagcagcctaagtcattgaactatgggggcattggcatg
gtcataggacacgaaatcacccatggcttcgatgacaatggcagaaattttaacaaggat
ggagaccttgttgactggtggactcaacagtctgcaaataattttaaagacctatcccag
tgcatggtgtaccagtatgggaacttctcctgggacctagcaaatggacagcatctcaat
ggaattaatacactgggagaaaacattgctgataatggtggtattggccaagcatacaga
gcctatcaaaactatgttaaaaagcatggtgaagaaaaattacttcctggacttgaccta
aatcacagacaactgttcttcctgaattttgcccaggtgtggtgtggaacctacaggacg
gagtatgctctcaactccattaaaacagatgtgcacagtccaggcaatttcaggattatt
gggactttgcagaactctcctcagttttcagaagccttccattgtcgcaagaattcatac
atgaatccagaaaagaaatgccgggtttggtaa

DBGET integrated database retrieval system