KEGG   Bos indicus (zebu cattle): 109559273
Entry
109559273         CDS       T04792                                 

Gene name
TBK1
Definition
(RefSeq) serine/threonine-protein kinase TBK1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04014  Ras signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04657  IL-17 signaling pathway
biu05014  Amyotrophic lateral sclerosis
biu05022  Pathways of neurodegeneration - multiple diseases
biu05135  Yersinia infection
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109559273 (TBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109559273 (TBK1)
   04137 Mitophagy - animal
    109559273 (TBK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109559273 (TBK1)
   04621 NOD-like receptor signaling pathway
    109559273 (TBK1)
   04622 RIG-I-like receptor signaling pathway
    109559273 (TBK1)
   04623 Cytosolic DNA-sensing pathway
    109559273 (TBK1)
   04657 IL-17 signaling pathway
    109559273 (TBK1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109559273 (TBK1)
   05022 Pathways of neurodegeneration - multiple diseases
    109559273 (TBK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109559273 (TBK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109559273 (TBK1)
   05161 Hepatitis B
    109559273 (TBK1)
   05160 Hepatitis C
    109559273 (TBK1)
   05171 Coronavirus disease - COVID-19
    109559273 (TBK1)
   05164 Influenza A
    109559273 (TBK1)
   05162 Measles
    109559273 (TBK1)
   05168 Herpes simplex virus 1 infection
    109559273 (TBK1)
   05163 Human cytomegalovirus infection
    109559273 (TBK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559273 (TBK1)
   05169 Epstein-Barr virus infection
    109559273 (TBK1)
   05165 Human papillomavirus infection
    109559273 (TBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109559273 (TBK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109559273 (TBK1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     109559273 (TBK1)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109559273 (TBK1)
Membrane trafficking [BR:biu04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    109559273 (TBK1)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal DUF713 Kinase-like CEP63
Other DBs
NCBI-GeneID: 109559273
NCBI-ProteinID: XP_019816443
UniProt: A0A6P5BT89
LinkDB
Position
5
AA seq 729 aa
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRMIVHVFSLQQMTAHKVYIHGYNTATVFHELVYKQTKIISSNQELIYEGRRLV
LEPGRLAQHFPKTSEENPIFVVSREPLSTIGLIYEKISLPKVHPRYDLDGDASMAKAMTG
VVCYACRIASTLLLYQELVRKGIRWLIELVKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIESKLSPGGLLADTWTHQE
GTHPKDRHVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYEAFLDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQ
KMFAASSGIKHTMTPIYPCSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgcagagcacttctaatcatctgtggcttttatctgatattttaggccaaggagctact
gcaaatgtttttcgtggaagacataagaaaactggtgacttatttgctatcaaagtattt
aataacataagcttccttcgtccagtggatgttcaaatgagagaatttgaagtgttaaaa
aaactgaatcacaaaaacattgtcaaattatttgctattgaagaggagacaacaacaaga
cataaagtacttattatggaattttgtccatgtgggagtttatacactgttttagaagaa
ccatctaatgcctatggactaccagagtctgagtttctaattgttttgcgagatgtggtg
ggtggaatgaatcatctccgagagaatggcatagttcaccgtgatatcaagccaggaaat
atcatgcgtgtgataggggaagacggacagtctgtgtacaaactcacagattttggtgca
gctagagaattagaagatgatgagcagtttgtttctctgtatggcacagaagaatatttg
catcctgatatgtatgagagagcagtgctaagaaaagatcatcagaagaaatacggagca
actgtggatctttggagcattggggtaacattttaccatgcagctactggatcactgcca
tttagaccatttgaagggccacgtaggaataaggaagtgatgtataaaataattactgga
aagccttctggtgcaatatctggagtacagaaagcagaaaatggaccaattgactggagt
ggagacatgcctgtttcttgtagtctttctcggggtcttcaagttctgcttactcctgtt
cttgcaaacatccttgaggcagatcaagaaaagtgttggggttttgaccagttttttgca
gaaactagtgatatacttcaccggatgatagttcatgtcttttcactacaacaaatgaca
gctcataaagtttatattcatggctataatactgctactgtatttcatgaactagtatat
aaacaaaccaaaattatttcttcaaatcaagagcttatatatgaaggacgacgtttagtc
ctagaacctggaagactggcacagcatttccctaaaacttctgaggaaaaccctatcttt
gtagtaagccgggaacctctgagtaccataggattgatatatgaaaaaatttccctccct
aaagtacatccacgttatgatttagatggggatgccagcatggctaaggcaatgacagga
gttgtgtgttatgcctgtagaattgccagtaccttgctgctttatcaggaattagtgcga
aagggaatacgatggttgatagarttagttaaagatgactataatgaaactgttcacaaa
aagacagaagttgtgatcacattggatttctgcatcagaaacattgaaaaaactgtgaaa
gtatatgaaaagttgatgaagatcaacctagaagcagcagagttaggtgaaatttcagac
atacacaccaagctgttgagactttccagttctcagggaacaatagaaaccagtctccag
gatattgaaagcaaattgtctccaggtggattgcttgccgatacrtggacccatcaagaa
ggcactcatcccaaagatagacatgtagaaaagctacaagtcctgttaaattgcatcaca
gagatttactatcagttcaaaaaagacaaagcagaacgtagactagcttataatgaagaa
caaatccacaaatttgataagcaaaaactgtattatcatgcaacaaaagctatgacccac
tttacggatgaatgtgttaaaaagtatgaggctttcttggataagtcagaagaatggatg
agaaagatgcttcaccttaggaaacagttattatccctaactaatcagtgttttgatatt
gaagaagaagtatcaaagtatcaagaatatactaatgagttacaagaaactttgccacag
aaaatgttcgcagcctccagtggaatcaaacataccatgaccccaatttatccatgttct
aacacattagtagaaatgactcttggtatgaagaaattaaaggaagaaatggaaggggta
gttaaagaacttgctgaaaataatcatattttagaaaggtttggctcattaaccatggat
ggtggccttcgcaatgtcgactgtctttag

DBGET integrated database retrieval system