KEGG   Bos indicus (zebu cattle): 109559320
Entry
109559320         CDS       T04792                                 

Gene name
GLI1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04340  Hedgehog signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109559320 (GLI1)
   04024 cAMP signaling pathway
    109559320 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559320 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109559320 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109559320 (GLI1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    109559320 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 109559320
NCBI-ProteinID: XP_019816513
UniProt: A0A6P5BTG8
LinkDB
Position
5
AA seq 1105 aa
MFNSMTPPPVSSYGEPCCLRPLPSQGAPGMGTEGLPGLPFCHQATLMPGPHSYGPAREAN
SCTEVPLFPPPRSAVKLTKKRALSISPLSDTSLDLQTVIRTSPSSLVAFINSRCASPGGS
YGHLSIGTMSPSLGFSPQMNHQKGTSPSFGVQPCGPHDPTQSGMMPHPQSRGPLPTCQLK
SELGVLVNKCPEEPLEGDMSSPNSSSTQDPLLGMLDGREDLEREEKPEPDSVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPALSSVEPKRERDG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCLAGTGLSTLRRLENLRLDQLHQFRPMGPRGLKLPSLTHTGTPGSRRLGAPVSLD
RRSSSSSSVSSAYTVSRRSSLASPFPPGSPPENGASSLPGLTPAQHYLLRARYASARGGG
TPPTAAPSLDRTGALPAPPWRSRAEYPGYNPNVGVTRRASDPARSVDRPAPARVQRFKSL
GCVHNTPTVVGGGQNFDPQLPTSVYSPQPPSITENVSMDTRGLREEPEVGTSMMGSGLNP
YMDFPPADTLGYGGPEAAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQVPYSEPTPETW
SEFPSHSGLYSGPKAPAGAYSQCPRLEHYGQVQVKPEQGCPVGSDATGLAPCLNAHPNEG
PPRSQPLFSHYPQPPPPQYPQSGSYTQPPPDYLPSEARPSLDFESPTHSTGHLKAQLVCN
YVQSQQELLWDSGGRGDPPVQEPLYQSPKFLGGSQVSPSPAKAPVATYGPGFAPNMPNHK
PGSYPTPSCHENFAVGANKASHRAAAPPRLLPPLPACYGPLKAGGTNPSCGHPEVGRLGG
GPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHNQRDSSEHTPPPSGTP
NMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccaccagtcagtagctatggcgagccctgttgtctccgg
cccctccccagtcagggggcccccggcatggggacagaaggactgccaggtctgcccttc
tgtcatcaggccaccctcatgcccggcccccacagttatgggccagccagagaagccaac
agctgcacggaggtgccactgtttcctcctccccggagtgcagtcaaattgaccaagaag
cgggcactctccatctcacctctgtcggacaccagcctggacctgcagacagttatccgc
acctcacccagctccctcgtggccttcatcaactcacgctgtgcatctccggggggttcc
tatggtcacctctccatcggcaccatgagcccatctctgggattctcaccccagatgaac
caccagaaagggacctcaccttcttttggggtccagccctgtggtccccatgaccccacg
cagagtgggatgatgccgcatcctcagtcccggggacccctcccaacgtgccagctgaag
tctgagctgggtgtgctggttaacaagtgcccggaggagcccttggaaggtgatatgtcc
agtcccaactcctcgagcacacaggatccactgctggggatgctggatgggcgggaggac
ctagagagagaagagaaacctgagcctgactctgtgtatgagactgactgtcgctgggat
ggctgcagtcaggaattcgactcccaggagcaactggtgcatcacatcaacagtgagcac
atccatggagagcggaaggagttcgtgtgccattgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggtgcacatgcgcagacacacgggcgagaagcca
cataagtgcacgtttgaggggtgccggaagtcatactcacgcctggaaaatctgaagacg
cacctgcggtcacacactggtgagaagccatacatgtgtgagcatgagggctgcagtaaa
gccttcagcaatgccagtgaccgagccaagcaccagaatcggacccattccaatgagaag
ccctacgtgtgtaaactccctggctgcaccaaacgctacacagatcccagctcgctcagg
aaacatgtcaagacagtacacggtcctgatgcccacgtgaccaagcggcatcgaggagac
ggccccctgccccgggcaccggctctttcctcagtggaacccaagagggagcgggacgga
ggccccattagggaggagagcagactgactgtgccggagggtgccatgaagccacagccg
agtcctggggcccagtcgtcctgcagcagtgaccactccccagcaggcagcgcggccaat
acagacagcggtgtggaaatgactggaaatgcagggggcagcacggaggacctgtccagc
ttggatgaggggccttgccttgcgggaaccgggctgtctactcttcgccgccttgagaac
ctcaggctggaccagctacatcagttccggccgatggggccccggggcctcaaactgccc
agcttgacccacactggcactcctggctctcgccgtctgggcgccccagtatctcttgac
cgccgcagcagcagctccagcagtgtcagttcagcctatactgtcagccgccgctcctcc
cttgcctcccctttcccccctggttccccaccagagaacggggcatcctctctgcctggc
ctcacgcctgcccagcactacctgctccgggccagatatgcttcagccaggggaggtggt
accccacccactgcagcacccagcctggatcggacgggggctcttcctgcacctccctgg
agaagccgagctgagtatccaggatacaaccccaatgtaggggtcacccggagagccagt
gacccagcccgatctgttgaccgccctgccccagccagagtccagaggttcaagagtttg
ggctgtgtccacaacacccccacagtggtaggaggaggacagaacttcgatccccaactc
ccaacctctgtctactcaccacagccccccagcatcactgagaatgtctccatggatacc
agagggctacgcgaggagccagaggttgggacctccatgatgggcagtggtctgaacccc
tatatggacttcccacctgctgatactctgggatatggagggcctgaggcggcagcagct
gagccttatggagctagagggcccggctccctgcctcttgggcctggtccacccaccaac
tatggccccaacccctgtccccagcaggttccctattctgaaccaaccccagaaacatgg
agtgagttcccttcccactctgggctctactcaggccccaaggctccagctggagcctac
agccagtgtcctcgtcttgaacattatggacaagtgcaagtgaagccagaacaggggtgc
cccgtgggttctgacgccacaggactggcaccctgcctcaatgcccaccccaatgagggg
cctccccgctcacagcctctgttctcccactacccacagcctccccctccccagtatccc
cagtcaggttcctacacccagccacctcctgattatctgccttcagaagccaggcccagc
ctggatttcgagtcccccactcattctacaggacacctcaaggcgcagcttgtgtgtaat
tatgttcagtctcaacaggagctgctgtgggacagtggaggcaggggagaccctccagtc
caagaacctctctatcagagtcccaagtttctggggggttcccaggtcagcccaagccct
gccaaggccccagtggccacatatggacctggctttgcacctaatatgcccaatcacaag
ccaggctcctatcctaccccttcatgccatgaaaattttgcagtaggggccaacaaagct
tcccatagggcagcagcaccaccccgacttctacccccactaccggcttgctatgggccc
ctcaaggcagggggcaccaaccccagctgtggccatcctgaggtgggcaggctgggaggg
ggccccgccttgtaccctcctcctgaagggcaggtgtgtaaccctctggactctcttgat
ctcgacaacacgcagctggactttgtggctattctggatgaggcccaggggctgagtcct
cccccttctcacaatcagagggacagctctgaacacaccccacctccctctgggacccct
aacatggccgtgggcaacatgagtgtgttactaggatctctgcctggggagacacagttc
ctcaattctagtgcttaa

DBGET integrated database retrieval system