KEGG   Bos indicus (zebu cattle): 109559334
Entry
109559334         CDS       T04792                                 

Gene name
STAT6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04217  Necroptosis
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05161  Hepatitis B
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109559334 (STAT6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109559334 (STAT6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109559334 (STAT6)
   04659 Th17 cell differentiation
    109559334 (STAT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559334 (STAT6)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109559334 (STAT6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109559334 (STAT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109559334 (STAT6)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109559334 (STAT6)
SSDB
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Other DBs
NCBI-GeneID: 109559334
NCBI-ProteinID: XP_019816538
UniProt: A0A6P5BTI0
LinkDB
Position
5
AA seq 847 aa
MSLWGLVSKMPPEKLQRLYVDFPQHLRHLLGDWLENQPWEFLVGSDTFCCNMASALLSAT
VQRLQASAGEQGEGNTILQHISTLETIYQRDPLKLVATCRHILQGEKKAVMEQFHHLPMS
FHWKQEELKFNTVLRRLQHRAGETRLLREALQPGAEAGQVSLHSLIETPTNGTGPSEALV
TLLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELDPKTRAALISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSMPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSLTLGPNKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSIEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
PQMPTMVPSYDLGMAPDSSMNLQLGPDMVPQVYPPRSHSIPSYPALPREESVNMLPAFQE
PHLPMPPNLSQMSLPFDQPHPQGLLPCPPQDHAVSSPEPLLCSDVTMAEDSCLNQPVGGF
PQGTWVREDMFPPLLPPTEQDLTKLLLEGQGESGGGSLGPQPLLQPSPYGQSGISMSHLD
LRANPSW
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaaaatgcccccagaaaaactgcagcggctctatgtc
gactttcctcaacacctgcggcatctcctgggtgactggctggagaaccagccctgggaa
ttccttgtcggctcagacaccttctgctgcaacatggccagcgccctactttctgccact
gtccagcgccttcaggcctcagccggagagcagggggaggggaacaccatcttgcaacac
atcagcactctggagaccatttatcagagggaccccctgaagctggtggccacttgcaga
cacatacttcaaggtgaaaaaaaagctgttatggagcagttccaccacctgccaatgtcc
ttccactggaagcaggaggaactcaagtttaacacagtcctacggaggctgcagcaccgg
gccggggagacccgccttctccgggaggccctgcagcctggagctgaggctggccaagtg
tctttgcacagcttgatagaaacgcctaccaacgggactgggccaagtgaggccctggtc
acgctgctgcaggagactgttggtgagctggaagctgctcaggctctggtgctgaagagg
atccagatatggaagcggcaacagcagctggcagggaatggtgcaccctttgaggagagc
ctggctccactacaagagaggtgtgagagcctggtggacatttattcccagctgcagcag
gaggtgggggcagctggtggggagcttgatcccaagacccgggcagcgctgattagccga
ctggatgaagtcctgcgcacactcgtcaccagctctttcctggtggaaaagcagcccccc
caggttctgaagactcagaccaagttccaggccggagttcgattcctgctgggcctgagg
ttcctgggggccccagccaagcctccgctggtcagggccgacatggtcacggagaagcag
gcgagggagctgagcatgccccaggggcccggagctggagcagaaagcaccggagaaatc
atcaacaacaccgtgcccctggagaacagcattcctgggaactgctgctctgcgctgttc
aagaacctgcttctgaagaaaatcaagcggtgtgagcggaagggcaccgagtctgtcacc
gaggagaagtgcgctgtgctcttctccaccagcctcacgcttggccctaacaaactcccc
atccagctccaggccctgtctctgcccctggtggtcatcgtccatggcaaccaagacaat
aatgccaaagccaccatcctgtgggacaatgccttctctgagatggaccgcgtgcccttt
gtggtggctgagcgggtgccctgggagaagatgtgtgaaactctgaacctcaagttcatg
gctgaagtggggaccaaccgggggttactcccagagcacttcctcttcctggcccagaag
atcttcaatgacaacagcctcagtatagaggccttccagcaccgttctgtgtcctggtca
cagttcaacaaggagatcctgctgggtcgtggcttcaccttttggcagtggtttgatggt
gtcctggatctcaccaaacgctgtctccggagctactggtcagaccggttgatcattggc
ttcatcagcaaacagtacgtcactagccttcttctcaacgagcctgatggaaccttcctc
cttcgattcagtgactcagagattgggggcatcaccattgcccacgtcatccgaggccag
gatggctccccacagatagagaatatccagccattctctgccaaagacctgtccattcgc
tcacttggggaccgaatccgggacctcgctcagctcaaaaacctctaccccaagaaaccc
aaggatgaggctttccggagccactacaaacctgagcagatgggtaaggatggcaggggt
tatgtcccagctacaatcaagatgactgtggaaagggaccagccacttcccaccccagag
ccccaaatgcctaccatggtgccctcttacgatcttggaatggcccctgattcctccatg
aacctgcagctcggcccagatatggtgccccaagtgtacccaccacgctctcactccatc
ccctcatatccagccctcccccgggaagaatcagtcaatatgttgccagccttccaggaa
cctcacctgccgatgcctcccaacctgagccagatgagcctgccctttgaccaacctcac
ccgcagggcctgctgccgtgcccacctcaggatcatgctgtgtccagccctgagcccttg
ctctgctcagacgtgaccatggcagaagacagctgcctgaaccagccggtgggagggttc
cctcaaggcacctgggtccgtgaagacatgttcccgcccttgttgcctcccactgaacag
gaccttaccaagcttctcttggagggacaaggggagtcagggggagggtccttgggaccc
caacccctcctgcagccctccccctatgggcagtctgggatctcaatgtcccacctggac
ctaagagctaaccccagttggtga

KEGG   Bos indicus (zebu cattle): 109559357
Entry
109559357         CDS       T04792                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04062  Chemokine signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109559357 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109559357 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109559357 (STAT2)
   04625 C-type lectin receptor signaling pathway
    109559357 (STAT2)
   04062 Chemokine signaling pathway
    109559357 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109559357 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559357 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109559357 (STAT2)
   05160 Hepatitis C
    109559357 (STAT2)
   05171 Coronavirus disease - COVID-19
    109559357 (STAT2)
   05164 Influenza A
    109559357 (STAT2)
   05162 Measles
    109559357 (STAT2)
   05168 Herpes simplex virus 1 infection
    109559357 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559357 (STAT2)
   05169 Epstein-Barr virus infection
    109559357 (STAT2)
   05165 Human papillomavirus infection
    109559357 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109559357 (STAT2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109559357 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_bind STAT_int SH2
Other DBs
NCBI-GeneID: 109559357
NCBI-ProteinID: XP_019816579
UniProt: A0A6P5BTM3
LinkDB
Position
5
AA seq 857 aa
MAQWEMLQNLDSPFQDQLHELYSNSLLPMDVRQHLAVWIEDQNWQKAALGNDAAMANMLF
LHFLDQLNSECGRCSQDSEYFLLQHNLRKFYRDIQALPTGSTQLAEMIFNLLLEEKRILT
WAQRAQLEQREPAPEAPGESQQHELDSRILKLQAMKEKLVKSISQLKDQQDVFCFRYNIE
KSVRTPSLDPRQTRQMDILQETLNELDRQRKEVLDASKALLGQLTTLIELLLPKLEEWKV
QQQKACIGAPPVGGLEQLEKWFTDGAKLLFHLRQLLKELKELSHMVXYDGDPLNKGVDLR
EAQVTELLQRLLHRAFVVENQPCMPQTLHRPLILKTGSKFTVRTRLLVRLQEGNESLTAE
VSVDRDSPKSQGFRKFNILTSNQKTLTPEKGQTQGLIWDFGYLTLVEQRSGGSGKGNNKG
LLSVTEELHIISFTVKYTYQGLKQELTTDSLPVVIISNMNQLSIAWASVLWFNLLSSNPQ
DQQFFSNPPKAPWNLLGPALSWQFSSYVNRGLDSDQLGMLRDKLFGHNSXTEGASLSWVD
FIKRESPPGKLPFWTWLDKILDLIHDHLKDLWKDGRIMGFVSRNQVRRLLKKTVSGTFLL
RFSETLEGGITCSWVEHQDDDEVLINSVQPFTKEVLQSLPLTKIISQYQMLTEENIPENP
LRFLYPRIPRDEAFGCYSQEKINPEERKKYLKHKLIFVSNRQVDELQQLPELKLEPELES
LELGLGFTSGPEHGPGLDLEPLLEAGLDLSMEPMLEPTLEPTLGEVSQGVLEPHPGPQLQ
LEPIPELELQPMPEPDLPYDLRHLNTEDMEIFRNSMRIEEIMPNGDPVLPCQNTMDEADI
FNPSHFYADGPLSPSDY
NT seq 2574 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgctgcagaaccttgacagcccgtttcaggatcagctgcatgag
ctctactcaaatagcctcctgccgatggatgttcgacagcacttggctgtctggattgaa
gatcagaactggcagaaagctgcactgggaaatgatgctgccatggctaatatgctattc
ttgcacttcttggaccaactcaactctgagtgtggccgatgcagccaagactctgagtat
tttttgctacagcacaacttgcgaaaattctatcgagatattcaggcccttcccactggc
tctacccagttggctgagatgatctttaatctccttctggaagaaaaaagaattctgacc
tgggctcagagggctcagctggagcaacgagagccagcccctgaagcacctggggagagc
cagcagcatgaacttgattcccggatcctgaaattacaggctatgaaggagaagctggtg
aaatccatcagccaactgaaagaycagcaggatgtcttctgtttccgatataatattgag
aaatcagtgaggacaccttctttggacccccgtcagaccagacagatggacattcttcag
gaaacactcaatgaactggacagacagagaaaggaggtgctggatgcctccaaagcactg
ctaggccaattaactaccttaattgagctattgctgcccaagttggaggaatggaaagtc
cagcagcagaaagcctgcattggagcgccccctgtcggagggttggaacagctggagaag
tggttcacagatggagcgaagctgctgtttcacctgcggcagctgctgaaggagctgaag
gagttgagtcacatggtctyctatgatggggaccctctgaacaaaggggtggacctgcgg
gaggcccaggtcacagagctgctgcagcgcctgctccacagagcctttgtagtagaaaat
cagccctgcatgccccaaactcttcatcgacccctcatcctcaagacagggagcaagttc
accgtccgaacaaggctgctagtgagactccaggaaggcaatgaatcactgactgcrgaa
gtctccgttgacagggattctcccaaatcacaaggcttccggaagttcaacattctgacc
tcaaaccagaaaactttgactcccgagaaaggccagactcagggcttaatttgggacttt
ggctacctgactctggtggagcagcgttcagggggttcaggaaaaggcaacaataagggg
ctgctgtccgttacagaggaattgcacatcattagcttcacagtcaaatacacctaccag
ggtctgaagcaggagctgacaacggacagcctccctgtggtgattatttctaacatgaac
caactctcaattgcctgggcctctgttctctggttcaatctgctcagctcaaacccccag
gatcagcagttcttctccaaccccccgaaggccccatggaacttgctgggccctgctctc
agttggcaattctcctcctatgttaatcgaggccttgactcagaccagctaggcatgctg
agggacaagctgtttgggcacaactccargactgagggtgcatcgttgtcctgggttgac
ttcattaagcgagagagtccccctggcaagctaccgttttggacatggctcgacaagatt
ctggacctgatacatgaccacctgaaggatctctggaaggatggacgtatcatgggcttt
gtgagccggaaccaggtgcgccggctgctgaagaagactgtctccggcaccttcctgctg
cgctttagtgaaacgttggaggggggcattacctgctcctgggtggaacaccaagatgat
gacgaggtgctcatcaactctgtgcagcccttcaccaaggaggtgctgcagtcactccca
ctgaccaagatcatcagccagtaccagatgctcacggaggagaacatacctgagaaccca
ctgcgcttcctctacccgcgaatcccccgggatgaggcttttggttgctactcccaggag
aaaattaatcctgaggagcggaagaaatacctgaaacataagctcatttttgtctctaac
agacaggtggatgaactgcagcaactgccggagctcaagttggagccagagctggagtca
ttagagctgggtctggggttcacatcagggcctgagcacgggccaggcctggacttagag
ccactgctggaggcaggattggatctgagcatggagcccatgctggagcccacgctggag
cccacactaggcgaggtgtcacagggagtcctagaaccacacccgggaccacaactgcag
ctggagcctattccagagctcgaactacagcccatgccagaaccagatttgccctatgat
ctgagacacttgaacactgaggacatggaaatctttaggaacagcatgaggattgaagaa
atcatgccaaacggtgatccagtgttgccttgccagaacaccatggatgaagctgacatc
ttcaaccccagccacttctatgcagatgggcccttgagcccttctgactactag

KEGG   Bos indicus (zebu cattle): 109568771
Entry
109568771         CDS       T04792                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04062  Chemokine signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05140  Leishmaniasis
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05212  Pancreatic cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109568771 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109568771 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109568771 (STAT1)
   04621 NOD-like receptor signaling pathway
    109568771 (STAT1)
   04625 C-type lectin receptor signaling pathway
    109568771 (STAT1)
   04658 Th1 and Th2 cell differentiation
    109568771 (STAT1)
   04659 Th17 cell differentiation
    109568771 (STAT1)
   04062 Chemokine signaling pathway
    109568771 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109568771 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    109568771 (STAT1)
   04919 Thyroid hormone signaling pathway
    109568771 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109568771 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568771 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109568771 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109568771 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109568771 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109568771 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109568771 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109568771 (STAT1)
   05160 Hepatitis C
    109568771 (STAT1)
   05171 Coronavirus disease - COVID-19
    109568771 (STAT1)
   05164 Influenza A
    109568771 (STAT1)
   05162 Measles
    109568771 (STAT1)
   05168 Herpes simplex virus 1 infection
    109568771 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109568771 (STAT1)
   05169 Epstein-Barr virus infection
    109568771 (STAT1)
   05165 Human papillomavirus infection
    109568771 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109568771 (STAT1)
   05140 Leishmaniasis
    109568771 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109568771 (STAT1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109568771 (STAT1)
SSDB
Motif
Pfam: STAT_bind STAT1_TAZ2bind SH2 MINDY_DUB
Other DBs
NCBI-GeneID: 109568771
NCBI-ProteinID: XP_019829724
UniProt: A0A6P5CX30
LinkDB
Position
2
AA seq 425 aa
MPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILG
THTKVMNMEESTNGSLAAEFRHLQLKEQKNAGARTNEGPLIVTEELHSLSFETQLCQPGL
VIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLNPPCARWSQLSEVLSW
QFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFPFWLWIESILEL
IKKHLLALWNDGCIVGFISKXRERALLKDQQPGTFLLRFSESCREGAITFTWVERSQNGG
EPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKFLYPNIDKDHAFGKYYSRP
KEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRMVGSVEFD
MMNAV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgccaactcaccctcagaggccattggtcttgaagactggagtccagttcactgtgaag
ctgaggctgctggtgaagttgcaagagctgaattataacttgaaagtcaaagtcttattt
gacaaagatgtgaatgagagaaatacagtaaaagggtttaggaagttcaacattctgggc
actcacacgaaggtgatgaacatggaagagtccaccaacgggagtctggcggcagaattc
cgacacctgcaactgaaagaacaaaaaaatgctggtgccagaactaatgagggtcctctc
atcgtcactgaagagcttcactcccttagttttgaaacccagttgtgccagcctggtttg
gtcattgaccttgagacgacctctctacccgtcgtggtgatctccaatgtcagccagctc
ccaagtggctgggcctctatcctgtggtacaacatgctggtggcagaaccccggaatctg
tccttcttcctgaacccaccttgtgcacgatggtctcagctttcagaggtgctgagttgg
cagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaacatgctgggggag
aagcttcttggccccaacgccggccccgatggtctgattccatggacaaggttctgtaag
gaaaatataaatgataaaaattttccgttctggctttggatcgaaagcatccttgaactc
attaaaaaacacctgcttgctctctggaatgatgggtgtatcgtgggctttattagcaag
grgcgagagcgagccctgctgaaggaccaacagcctgggacgttcctgctgcgcttcagc
gagagctgccgggaaggggcgatcacgttcacgtgggtggaacggtcccaaaatggaggt
gaaccttacttccacgcggttgaaccctacacaaagaaagaactttctgcggttactttt
cctgacattattcgtaattataaagtcatggctgctgaaaatattccagagaatcccctg
aagtttctgtatccaaatattgataaagaccatgcctttggaaaatactactccaggcca
aaggaagccccagagcctatggaacttgatggccctaaaggaacaggatacatcaagact
gaattgatttctgtgtctgaagttcacccttctcgacttcagaccacagacaaccttctt
cccatgtctcctgaggagtttgacgaggtgtctcggatggtgggctctgtagaattcgat
atgatgaatgcggtctag

KEGG   Bos indicus (zebu cattle): 109573773
Entry
109573773         CDS       T04792                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04012  ErbB signaling pathway
biu04062  Chemokine signaling pathway
biu04217  Necroptosis
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04917  Prolactin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109573773 (STAT5B)
   04630 JAK-STAT signaling pathway
    109573773 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109573773 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109573773 (STAT5B)
   04659 Th17 cell differentiation
    109573773 (STAT5B)
   04062 Chemokine signaling pathway
    109573773 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109573773 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    109573773 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573773 (STAT5B)
   05203 Viral carcinogenesis
    109573773 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109573773 (STAT5B)
   05220 Chronic myeloid leukemia
    109573773 (STAT5B)
   05223 Non-small cell lung cancer
    109573773 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109573773 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109573773 (STAT5B)
   05161 Hepatitis B
    109573773 (STAT5B)
   05162 Measles
    109573773 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109573773 (STAT5B)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109573773 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 109573773
NCBI-ProteinID: XP_019836757
UniProt: A0A6P5DGH3
LinkDB
Position
19
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASADSAG
GSATYMDQAPSPAVCPQPHYNMYPQNPDPVLDNDGDFDLDDTIDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggagatgcccttcatcagatgcaagcr
ctgtacggycagcatttccccattgaggtgcgccattacttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagttgcagaagaaggcagagcaccaagtgggggaagacggg
ttcctactgaagatcaagctggggcactacgccacacagctccagaacacatatgaccgc
tgccccatggagctggtgcgctgcatccgccatattytgtacaatgaacagaggctggtc
cgagaagccaacaatggtacttctccggctggaagtctcgccgatgccatgtcccagaaa
caccttcaaatcaaccagacatttgaggagctgcgactggtcacacaagacacagagaat
gagctgaagaagctgcagcagactcaagagtactttatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgactgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgaaaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggatgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
actgacatcatctcagccctggtgaccagcaccttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagcgagcagcaggccaag
tcactgctcaagaacgagaacacccgcaatgattacagtggggagatcctgaacaactgc
tgtgtaatggagtaccaccaggccacaggcaccctgagcgcccacttccggaacatgtcc
ctgaaacgaattaagagatctgaccggcgtggagcagagtcggtgacagaagaaaaattt
accatcctgtttgaatcacagttcagtgttggcggaaatgagctggtgtttcaagtcaag
accctgtctctcccagtggtggtgattgttcacggcagccaggataacaatgcgacggcc
accgttctctgggacaacgcttttgcagagcctggcagggtgccgtttgcagtgcccgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcagccatctcgaggactacaacggcatgtccgtgtcctggtcccagttcaaccgg
gagaatttacccggacggaattacactttctggcagtggtttgatggtgttatggaagtg
ttaaagaaacatctcaagcctcattggaatgacggggctatcttgggtttcgtgaacaag
caacaggcccacgacctgcttatcaacaagccagacgggaccttcctgctgaggttcagt
gactctgaaatcggtggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagatttctccatccggtccctggccgaccgcttg
ggagacctgagttaccttatctacgtgtttcctgaccggcccaaagacgaagtgtactcc
aagtattacaccccagttccatgcgagcctgccactgctaaagcagtggacggrtacgtg
aagccacagatcaagcargtggtccctgagtttgtgagcgcctctgcagactctgccggm
ggcagtgccacctacatggaccaggctccctccccagccgtgtgcccccagcctcactat
aacatgtacccacagaaccccgaccccgtccttgacaacgatggtgacttcgatctggac
gacacgattgacgtggcgcggcgtgtggaggagctcctaggccgacccatggacagtcag
tggatcccccacgcacagtcgtga

KEGG   Bos indicus (zebu cattle): 109573817
Entry
109573817         CDS       T04792                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04217  Necroptosis
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04630  JAK-STAT signaling pathway
biu04659  Th17 cell differentiation
biu04917  Prolactin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04931  Insulin resistance
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05145  Toxoplasmosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05212  Pancreatic cancer
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109573817 (STAT3)
   04066 HIF-1 signaling pathway
    109573817 (STAT3)
   04068 FoxO signaling pathway
    109573817 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109573817 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109573817 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109573817 (STAT3)
   04062 Chemokine signaling pathway
    109573817 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109573817 (STAT3)
   04917 Prolactin signaling pathway
    109573817 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    109573817 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573817 (STAT3)
   05206 MicroRNAs in cancer
    109573817 (STAT3)
   05205 Proteoglycans in cancer
    109573817 (STAT3)
   05203 Viral carcinogenesis
    109573817 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109573817 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109573817 (STAT3)
   05221 Acute myeloid leukemia
    109573817 (STAT3)
   05223 Non-small cell lung cancer
    109573817 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109573817 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109573817 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109573817 (STAT3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109573817 (STAT3)
   05160 Hepatitis C
    109573817 (STAT3)
   05171 Coronavirus disease - COVID-19
    109573817 (STAT3)
   05162 Measles
    109573817 (STAT3)
   05163 Human cytomegalovirus infection
    109573817 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109573817 (STAT3)
   05169 Epstein-Barr virus infection
    109573817 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109573817 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109573817 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109573817 (STAT3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109573817 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 109573817
NCBI-ProteinID: XP_019836841
UniProt: A0A6P5DF35
LinkDB
Position
19
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEAAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctggacacacggtacttggagcagctccatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatacgcggccagcaaagaatcacatgcgactttggtgtttcataatctc
ttgggagaaattgaccaacagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatttgcgaagaatcaagcagttccttcagagyagataccttgagaagccaatggag
attgcccgaattgtggcccgttgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgccgtggtaacggagaag
cagcagatgctggagcagcacctgcaggacgtccgcaagcgtgtccaggatctagaacag
aagatgaaagtggtagagaatctccaggatgatttcgatttcaactataaaactctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcggtgaccaggcagaagatg
cagcagctcgaacagatgcttactgccctggaccagatgcggcgcagcatcgtgagtgag
ctggcggggcttttgtcagcratggagtatgtgcagaaaactctcacggatgaagaattg
gctgactggaagaggcgacaacagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattagcagaatctcagcttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaggttagctacaaaggggaccccattgtacag
caccggccaatgctggaggagagaatcgtggagctgtttagaaacttaatgaaaagtgcc
ttcgtrgtrgagcggcagccctgcatgcctatgcatcctgaccggccattagtcatcaag
accggtgtccagttcacaactaaagtcagattgctggttaaattccctgagctaaattat
caacttaagattaaagtgtgcattgacaaagactccggggacgttgcagctctcagaggg
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aatggcagcctctcagcggagttcaaacacttgaccctgagagagcagagatgcggtaat
gggggccgagccaattgtgatgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctggagacccactccttgcca
gtggtggtgatctccaacatctgtcagatgcccaatgcctgggcgtccatcctatggtac
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaaacccccgatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctctaccaccaagcgcgggctg
agcatcgagcagttgacgacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctggccctttgg
aacgaagggtatataatgggcttcatcagcaaggagagggaacgggccatcttgagcact
aagcccccaggtaccttcctgctgagattcagtgaaagcagcaaagaaggaggcgtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcagtggaaccttac
accaagcagcagctgaacaacatgtcatttgctgaaataatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccactggtctatctctaccccgacattccaaaggag
gacgcgttcggaaagtactgtcggccrgagagccaggagcatcctgaagccgacccaggt
agtgctgccccgtacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaagctgctgaaccctcagcaggagggcagtttgagtccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

KEGG   Bos indicus (zebu cattle): 109574089
Entry
109574089         CDS       T04792                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A-like
  KO
K11223  signal transducer and activator of transcription 5A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04012  ErbB signaling pathway
biu04217  Necroptosis
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04917  Prolactin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109574089
   04630 JAK-STAT signaling pathway
    109574089
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109574089
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109574089
   04659 Th17 cell differentiation
    109574089
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109574089
   04935 Growth hormone synthesis, secretion and action
    109574089
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574089
   05203 Viral carcinogenesis
    109574089
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109574089
   05220 Chronic myeloid leukemia
    109574089
   05223 Non-small cell lung cancer
    109574089
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109574089
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109574089
   05161 Hepatitis B
    109574089
   05162 Measles
    109574089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109574089
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109574089
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 109574089
NCBI-ProteinID: XP_019837399
UniProt: A0A6P5DI68
LinkDB
Position
19
AA seq 808 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSSAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVLGASAHPRAPPPTPPTWTRLLPQPCAPSLTITCT
HRTLTRCSTRMENSTWTRPWMWPGTWKNSSAAQWTVWSPLSPRPLVSLPPAEARCPECLF
EHCTPLWKQSXVCRVLFIVILYLYLCAY
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgccctgcgccagatgcaggtg
ctatacgggcagcacttccccatcgaggtccggcattacttggcacagtggattgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgagcccaggccacccagctc
ctggagggcctggtgcaggagttgcagaagaaggcagagcaccaagtcggggaagacggg
ttccttctgaagatcaagctggggcactatgccacgcagctccagaacacgtacgaccgc
tgccccatggagctggtgcgctgcattcgccatattctgtacaatgaacagaggctggtc
cgagaagccaacaatggtagttcttctgctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacrtttgaggaactgcgactggtcacgcaggacacagagaat
gagctgaagaagctgcagcagactcaagagtatttcatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgactgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatyctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggatgtgctacagtcctggtgtgag
aagttggcggagatyatctggcagaaccggcagcagatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
actgacatcatctcagccctggtgaccagcaccttcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagcgagcagcaggccaag
tcactgctcaagaacgagaacacccgcaatgagtgcagcggggagatcctgaacaactgc
tgtgtgatggagtatcaccaggccacaggcaccctcagcgcccacttcagaaacatgtcc
ctcaagaggatcaagcgagctgaccggcgaggtgcagagtctgtgacggaagagaagttc
acggtcctgtttgagtctcaattcagtgttggcagcaatgagcttgtgttccaggtgaag
accctgtcccttcccgtggttgtcatcgttcatggcagccaggaccacaatgctactgcc
acggtgctgtgggacaatgcctttgctgagccgggcagggtgccgtttgcggtgcccgac
aaagtcttgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcagccatctcgaggactacaacggcatgtccgtgtcctggtcccagttcaaccgg
gagaacttgcccggctggaactacaccttctggcagtggttcgacggggtcatggaggtg
ctgaagaaacatcacaagccccattggaatgacggggccatcctaggttttgtgaacaag
caacaggcccatgacctgctcatcaacaagcccgacggtaccttcttgttgcgcttcagc
gactcagaaattgggggcatcaccatcgcctggaagtttgactctcctgaccgtaacctg
tggaatctgaagccattcaccacgcgggatttctccatccgatccctggccgacaggttg
ggggacctgaactatctcatctacgtgtttcccgaccggcccaaggatgaggtcttctcc
aagtactatactcctgtgcttggtgcgtctgcccacccccgagcccctcccccaacgcca
cctacatggaccaggctccttccccagccgtgtgcccccagcctcactataacatgtacc
cacagaaccctgacccggtgctcgaccaggatggagaattcgacctggacgagaccatgg
atgtggcccggcacgtggaagaactcctccgccgcccaatggacagtctggagccctctc
tccccccgcccactggtctctttacccccggcagaggctcgctgtcctgaatgtttgttc
gaacactgcactcctctgtggaaacaatccycagtgtgcagggtcctattcattgtgatt
ttgtatttgtatctctgtgcatactga

KEGG   Bos indicus (zebu cattle): 109575487
Entry
109575487         CDS       T04792                                 

Gene name
STAT4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04217  Necroptosis
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu05161  Hepatitis B
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109575487 (STAT4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109575487 (STAT4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109575487 (STAT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575487 (STAT4)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109575487 (STAT4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109575487 (STAT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109575487 (STAT4)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109575487 (STAT4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 PARG_cat Prp19 NPV_P10
Other DBs
NCBI-GeneID: 109575487
NCBI-ProteinID: XP_019839222
UniProt: A0A6P5DQA0
LinkDB
Position
2
AA seq 783 aa
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNSALMNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNSMLVEELQDWKR
RQQIACIGGPLHSGLDQLQNCFTLLAESLFQLRRQLEKLEEQSSKMTYEGDPIPLQRAHL
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLSQCIIQHTSTKAIWKY
FPNMCSIKQVMSILVKRQKSSWFYRNASTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFR
HLQPKEMKSSAGNKGNEGCHMVTEELHSITFETQICLYGLTIDLETCSLPVVMISNVSQL
PNAWASIIWYNVSTNDSQNLVFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAE
KLTVQSSYNDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYIMGFVSK
EKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFAD
ILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTEKGDKGYVPSVFIP
ISTISSSRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAVCSLSFHCFQGHFSGSE
GGM
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagttagaaataaaatttttggagcaagtcgatcaa
ttctatgatgacaactttcctatggaaattcggcatctgctggcccagtggattgaaaat
caggactgggaggcagcatctaacaatgaaactatggcaacaattcttcttcaaaacttg
ttaatacaactggatgaacagttaggccgtgtttccaaagagaaaaacctacttttaatt
cacaatctgaaaagaattaggaaagtccttcagggaaaatttcatggaaacccaatgcat
gtagctgtggttatttcaaattgtttaagggaagagaggagaatattggctgccgccaac
atgcctgttcagggacctctggagaaatccttacaaagttcttcagtttcagaaagacag
aggaatgtggagcacaaagtggctgccattaaaaatagcgtgcagatgacagaacaagac
accaaatatttagaagatctacaagatgaatttgattacaggtataaaacaattcagaca
atggatcagggtgacaagaacagtgccctaatgaatcaggaagttttaactctgcaggaa
atgctgaacagcctggacttcaaaagaaaggaagccctgagtaagatgacacaaatagtg
aatgagacggacttgttaatgaacagcatgctggtggaggagctgcaagactggaagagg
cgacagcaaatcgcctgcattggaggtccactccacagtgggctcgaccagcttcaaaac
tgctttacactgttggcagaaagtctgttccaactcagacggcagttggagaaattagag
gagcaatcttcgaaaatgacatacgaaggagatcctatcccattgcaaagagcacatctg
ctagaaagagtcaccttcttgatctacaacctttttaagaactcatttgtggttgaacga
cagccatgcatgccaacccaccctcagaggccgatggtacttaagactctcattcagttt
actgtaaagctaagccaatgcattatccaacatacatcaactaaagcaatatggaaatac
tttccaaatatgtgttctattaagcaggtgatgtcaatattagtaaaacggcaaaaatct
tcttggttttacaggaatgcttcaactctaagcaatcgaagattcgtactttgtggaact
cacgtcaaagccatgtccattgaagaatcttccaacgggagtctctctgtagaatttcga
catttgcagccaaaggaaatgaagtctagtgctggaaacaaaggaaatgagggctgtcac
atggtgactgaggagcttcattccataacatttgagacacagatctgcctctatggactg
accatagatttggagacctgctcattacctgtggtgatgatttccaacgtcagtcaatta
cctaatgcttgggcgtccatcatttggtacaatgtgtcaaccaacgattcccagaacttg
gttttctttaataatcctccatctgccactttgagtcaactcctggaagtgatgagctgg
cagttttcatcatacgttggtcgtggcctgaactcagatcagctcaacatgctggccgag
aagctaacagtccagtctagctacaatgatggtcatctcacctgggccaagttctgcaag
gaacacttgcctggtaaatcatttaccttttggacctggcttgaagcaattttagaccta
attaagaaacacattcttcccctttggattgatgggtacatcatgggctttgttagcaaa
gaaaaggaacgactcttactaaaggataaaatgcctgggacctttttgttaagattcagt
gaaagccaccttggaggaataactttcacctgggtggaccattctgaaaacggagaagtg
agattccattctgtggaaccctacaacaaaggccggctgtccgctctgccgtttgctgac
atccttcgagactacaaggttattatggctgaaaacattcccgaaaaccctctgaagtac
ctctatcctgatattcccaaagacaaagccttcggtaaacactacagctcccagccatgc
gaagtttcaagaccaacagaaaagggagacaaaggttatgtcccttctgtttttatcccc
atctcaacaatctcttcaagccgaagtgattctacggagccacattctccatcagacctt
cttcccatgtcgccaagtgtatatgcagtgctgagagaaaacctgagtcccacaacaatc
gaaactgcagtatgttccctttctttccactgctttcaagggcatttctcaggaagtgaa
ggtggtatgtga

DBGET integrated database retrieval system