KEGG   Bos indicus (zebu cattle): 109559386
Entry
109559386         CDS       T04792                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04115  p53 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04914  Progesterone-mediated oocyte maturation
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
biu05222  Small cell lung cancer
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109559386 (CDK2)
   04151 PI3K-Akt signaling pathway
    109559386 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109559386 (CDK2)
   04114 Oocyte meiosis
    109559386 (CDK2)
   04115 p53 signaling pathway
    109559386 (CDK2)
   04218 Cellular senescence
    109559386 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109559386 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559386 (CDK2)
   05203 Viral carcinogenesis
    109559386 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    109559386 (CDK2)
   05215 Prostate cancer
    109559386 (CDK2)
   05222 Small cell lung cancer
    109559386 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109559386 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559386 (CDK2)
   05161 Hepatitis B
    109559386 (CDK2)
   05160 Hepatitis C
    109559386 (CDK2)
   05162 Measles
    109559386 (CDK2)
   05169 Epstein-Barr virus infection
    109559386 (CDK2)
   05165 Human papillomavirus infection
    109559386 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109559386 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109559386 (CDK2)
   03036 Chromosome and associated proteins [BR:biu03036]
    109559386 (CDK2)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109559386 (CDK2)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109559386 (CDK2)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109559386 (CDK2)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109559386 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase
Other DBs
NCBI-GeneID: 109559386
NCBI-ProteinID: XP_019816638
UniProt: A0A6P5BTT4
LinkDB
Position
5
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINADGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHARCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPYPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggaacgtacggagttgtgtacaaa
gccaaaaacaagttgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acagagggtgtacccagtactgccatacgagagatctctctgcttaaggagcttaatcac
cctaatattgtcaagctgctggatgtcattcacacagaaaacaaactctacctggttttt
gagtttctgcaccaggatctcaagaaattcatggatgcctctgcgctcactggcattcct
cttccgctcataaagagctacttgttccagctgctccagggcctagctttctgccactct
catcgagtcctgcaccgagaccttaaacctcagaacctgcttatcaacgcagatgggtcc
atcaagctagcagactttggactagccagagcttttggggtccctgttcgtacttatacc
cacgaggtggtgactctgtggtaccgagcaccggaaatccttctgggctgcaaatactac
tccacagcagtggacatatggagcctcggttgcatctttgctgagatgcacctagtgtgt
acccagcaccatgctaggtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccataccccgtgacccgccgggccctattccccggagattctgagatcgaccaactc
ttccggatctttcggaccctgggaaccccagatgaggtggtttggccaggagttacttct
atgcctgattataagccaagtttccccaagtgggccaggcaggattttagcaaagtggtg
cctcccctggatgaagatggacggagcttgttatcgcaaatgctgcactacgaccctaac
aagcggatttcagccaaggcagctctggctcaccctttcttccaagatgtgaccaagcca
gtacctcaccttcgactctga

DBGET integrated database retrieval system