KEGG   Bos indicus (zebu cattle): 109559493
Entry
109559493         CDS       T04792                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00860  Porphyrin and chlorophyll metabolism
biu01100  Metabolic pathways
biu04066  HIF-1 signaling pathway
biu04216  Ferroptosis
biu04978  Mineral absorption
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05225  Hepatocellular carcinoma
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    109559493 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109559493 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    109559493 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    109559493 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559493 (HMOX1)
   05206 MicroRNAs in cancer
    109559493 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109559493 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109559493 (HMOX1)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     109559493 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 109559493
NCBI-ProteinID: XP_019816832
UniProt: A0A6P5BUG8
LinkDB
Position
5
AA seq 289 aa
MERPQPDSSMPQDLSEALKEATKEVHTQAENAEFMKNFQKGELTQEGFKLVMASLYHIYV
ALEEEIERNKENPVYTPLYFPEELHRRASLEQDMAFWYGPRWQEAIPYTQATKRYVQRLQ
EVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALXLPSSGEGLAFFTFPNIASATKFK
QLYRSRMNTLEMTPEVRQRVLDEAKTAFLLNIQLFEELQGLLTQKAKDHDPLQAPELHRR
AGSKVQDLAPTKASRGKPQPSVLSQAPLLRWVLTLSFLVATVAVGLYAM
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagcgcccgcagcccgacagcagcatgccccaggatttgtcagaggccctgaaggag
gccaccaaggaggtgcacacccaggcggagaatgcagagttcatgaagaactttcagaag
ggtgagctgacccaagaaggttttaagctggtgatggcgtctttgtaccacatctatgtg
gccctggaggaggagatcgaacgcaacaaggagaaccccgtctacactcccctctacttc
ccagaggagctgcaccgccgggcctccctggagcaggacatggccttctggtacgggccc
cgctggcaggaggccatcccctacacgcaggccaccaagcgctatgttcagcgactccag
gaggtggggcgcaccgagcccgaactgctggtggcccatgcctacacccgctacctggga
gacctgtctgggggccaagttctcaagaagattgctcagaaggccctgartctgcccagc
tccggggagggcctggccttcttcactttccccaatatcgccagtgccaccaagttcaag
cagctgtaccgctcccgcatgaacactctggagatgacccctgaggtccggcagagggtc
ctggatgaggccaagaccgccttcctgctcaacatccagctgtttgaggagttgcagggc
ctgctgacccagaaggccaaggaccatgatcccttgcaggcaccagagcttcacaggcga
gccggcagcaaggtgcaagacttggctcccaccaaggcgtccagggggaagccccagccc
agcgtcctctcccaggcacctctcctgcgatgggtcctcacactcagctttctggtggcc
acggtcgctgtggggctttacgccatgtga

DBGET integrated database retrieval system