KEGG   Bos indicus (zebu cattle): 109559729
Entry
109559729         CDS       T04792                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04064  NF-kappa B signaling pathway
biu04071  Sphingolipid signaling pathway
biu04150  mTOR signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04668  TNF signaling pathway
biu04920  Adipocytokine signaling pathway
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109559729 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    109559729 (TNFRSF1A)
   04668 TNF signaling pathway
    109559729 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    109559729 (TNFRSF1A)
   04150 mTOR signaling pathway
    109559729 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109559729 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109559729 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109559729 (TNFRSF1A)
   04215 Apoptosis - multiple species
    109559729 (TNFRSF1A)
   04217 Necroptosis
    109559729 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109559729 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109559729 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559729 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    109559729 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    109559729 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109559729 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109559729 (TNFRSF1A)
   04931 Insulin resistance
    109559729 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109559729 (TNFRSF1A)
   05152 Tuberculosis
    109559729 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559729 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    109559729 (TNFRSF1A)
   05160 Hepatitis C
    109559729 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    109559729 (TNFRSF1A)
   05164 Influenza A
    109559729 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    109559729 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    109559729 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559729 (TNFRSF1A)
   05165 Human papillomavirus infection
    109559729 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109559729 (TNFRSF1A)
   05142 Chagas disease
    109559729 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109559729 (TNFRSF1A)
   04090 CD molecules [BR:biu04090]
    109559729 (TNFRSF1A)
Cytokine receptors [BR:biu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109559729 (TNFRSF1A)
CD molecules [BR:biu04090]
 Proteins
  109559729 (TNFRSF1A)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 109559729
NCBI-ProteinID: XP_019817224
UniProt: A0A6P5BVF2
LinkDB
Position
5
AA seq 471 aa
MGLPTVPGLLLPLVLPALLADVYPAGVQGLVPHPGDLEKRESPCPQGKYNHPQNSTICCT
KCHKGTYLYNDCPGPGRDTDCRVCAPGTYTALENHLRRCLSCSRCRDEMFQVEISPCVVD
RDTVCGCRKNQYREYWGETGFRCLNCSLCPNGTVNIPCQERQDTICHCHMGFFLKGAKCI
SCHDCKNKECEKLCPTRPSTGKDSQDPGTTVLLPLVIVFGLCLASFASVVLACRYQRWKP
KLYSIICGQSTLVKEGEPELLVPAPGFNPTTTICFSSTPSSSPVSIPPYISCDRSNFGAV
ASPSSETAPPHLKAGPILPGPPASTHLCTPGPPASTHLCTPGPPASTHLCTPVQKWEASA
PSAPDQLADADPATLXAVVDGVPPSRWKELVRXLGLSEHEIERLELENGRHLREAQYSML
AAWRRRTPRREATLELLGRVLRDMDLLGCLENIEEXLGGAARLASEPRLLX
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcctgctgctgccactggtgcttccagctctgttggca
gatgtgtaccccgcaggggttcaggggctggtccctcaccccggggacctggagaagaga
gagagtccctgtccccaaggaaaatataaccacccgcaaaatagcaccatttgctgcacc
aagtgccacaaaggtacctatctgtacaatgactgtccgggtccagggcgagacacggac
tgcagggtgtgtgcccctggcacctacactgccttggagaaccatctcagacgatgcctg
agctgctccaggtgccgggacgaaatgttccaggtggagatttcgccttgtgtagtggac
cgggacactgtgtgcggctgcaggaagaaccagtaccgggaatactggggtgaaactggc
ttccggtgtctgaactgcagcctctgtcccaatggcacagtgaatatcccctgccaggag
agacaggacaccatctgccactgccatatgggcttctttcttaaaggcgccaagtgcatc
tcctgtcatgattgtaagaacaaggagtgcgagaagttatgtccaacccgaccttcaact
ggtaaagactctcaggacccaggcactacagtactattacccctggtgattgtcttcggg
ctttgcctggcatccttcgcctctgtcgtcttagcatgtcgctaccagcggtggaagccc
aagctctactccatcatttgcgggcagtcgactctggtaaaagagggggagccagaactc
ctggtcccggccccaggcttcaaccccaccaccacsatctgcttcagctccaccccaagt
tccagtcctgtctccattcccccttacatctcctgtgaccggtccaacttcggagccgtc
gcatctccctccagcgagacggccccgccccatctaaaggctggccccatcctcccgggg
cctccggcctccacccacctctgtaccccggggcctccggcctccacccacctctgtacc
ccggggcctccggcctccacccacctctgcaccccagttcagaagtgggaagccagcgcc
cccagcgcccccgatcagctcgcggatgccgaccccgcgaccctnnacgcggtggtggac
ggcgtgcccccgtcgcgctggaaggagttggtgcggckgctgggactgagcgagcacgag
atcgagcggctggagctggagaacgggcgccacctgcgcgaggcgcagtacagcatgctg
gcggcctggcggcggcgcacgccgcgccgcgaggccacgctggagctgctgggccgcgtg
ctcagggacatggacctgctgggttgcctggaaaacatagaggaggygctgggtggcgcc
gcccgcctcgcgtccgagccccgccttctcyggtga

DBGET integrated database retrieval system