KEGG   Bos indicus (zebu cattle): 109559730
Entry
109559730         CDS       T04792                                 

Gene name
LTBR
Definition
(RefSeq) LOW QUALITY PROTEIN: tumor necrosis factor receptor superfamily member 3
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04064  NF-kappa B signaling pathway
biu04066  HIF-1 signaling pathway
biu04672  Intestinal immune network for IgA production
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109559730 (LTBR)
   04066 HIF-1 signaling pathway
    109559730 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109559730 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109559730 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    109559730 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109559730 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559730 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109559730 (LTBR)
Cytokine receptors [BR:biu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109559730 (LTBR)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 109559730
NCBI-ProteinID: XP_019817225
UniProt: A0A6P5BVG5
LinkDB
Position
5
AA seq 428 aa
MRLLWATSHRGLAWGLLILGVWGLLAASQPQLEREEPVQGLPYHTENQSCGDQEKEYYES
KLRLCCSRCPPGTHISTKCSRRQNTVCATCPEKSYNEHWNHLSFCQLCRPCDKMLGFVEL
TPCTSNRKAQCHCQPGMYCVFWNSECEHCEPLSDCPPGTEAELKDEVIEANSNCVPCKAG
HFQNTSSPTARCRPHTRCEDQGLVEEAPGTPQSDTSCRNPQEPPDMPGTMLVLAILLPLV
SFLLLTTVFVYTWKSHPSLCRKLGSLLKRHPEGEESNPADGNWEPPRFNTHVPDLVKPLL
PAPGDLALASGGVPANPGLEEEVLQQQSPLSQARDLDAEPPEQGQVAPGTNGIHVTGGSV
TVTGNIYIYNGPVLGGSPGPGDPPAPPEPPYPIPEEGAPRPPGLSMPYQEDGKAWHLAET
ETLGCYAL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgcgcctgctatgggccacctcccaccgcggcctggcctgggggctactcatcctgggc
gtctggggtctcctggccgcatcccaaccccagctggagagggaggagcctgtgcagggg
ctcccataccacacagagaaccaaagctgcggagaccaggaaaaggagtactatgagtcc
aagcttcgcctctgctgctcccgctgccccccaggcacgcacatctccaccaaatgtagc
cgccgccagaacaccgtctgtgccacatgccccgagaagtcgtacaacgagcactggaac
catctctccttctgccagctgtgccgcccctgtgacaagatgctgggcttcgtggagctc
acgccttgcactagcaaccgcaaggcccagtgccactgccagccggggatgtactgcgtc
ttttggaactctgagtgtgagcactgcgagccactctccgactgcccgcctggcaccgag
gccgagctcaaagatgaagtcatagaggctaacagcaactgtgtcccctgtaaagctgga
cacttccagaacacctcctctcccaccgcccgctgccggccccataccaggtgtgaggac
cagggccttgtggaggaagctccaggcaccccccagtctgacaccagctgcagaaatcca
caagagccccctgacatgccaggaacgatgctagttctggccatcctgctgcctctggtc
tcatttctgctcctcaccactgtcttcgtctacacctggaagagccacccctctctctgc
agaaagctgggatccctgctcaagaggcacccagagggagaggaatcaaatcctgctgat
ggaaactgggagcccccaaggttcaacacacatgttcctgacctggtaaagccacttctg
cccgctcctggagacttggccctggcctccggcggcgtcccagcgaacccgggtttggag
gaagaggtgctccaacagcagagtcccctgagccaggccagggacctggatgctgagccc
ccagaacaaggccaggtggcccccggcaccaacggcattcatgtcaccggagggtctgtg
acggtcaccggcaacatctacatctacaacgggccggtcctgggggggagcccgggccct
ggagacccccccgccccgccagagcctccgtaccccatccccgaagagggtgccccccgc
cctcccgggctttccatgccctaccaggaggatggcaaggcttggcacctggctgagaca
gagacactggggtgctacgccctctga

DBGET integrated database retrieval system