KEGG   Bos indicus (zebu cattle): 109559852
Entry
109559852         CDS       T04792                                 

Gene name
EP300
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04310  Wnt signaling pathway
biu04330  Notch signaling pathway
biu04350  TGF-beta signaling pathway
biu04520  Adherens junction
biu04630  JAK-STAT signaling pathway
biu04720  Long-term potentiation
biu04916  Melanogenesis
biu04919  Thyroid hormone signaling pathway
biu04922  Glucagon signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05016  Huntington disease
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05211  Renal cell carcinoma
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109559852 (EP300)
   04330 Notch signaling pathway
    109559852 (EP300)
   04350 TGF-beta signaling pathway
    109559852 (EP300)
   04630 JAK-STAT signaling pathway
    109559852 (EP300)
   04066 HIF-1 signaling pathway
    109559852 (EP300)
   04068 FoxO signaling pathway
    109559852 (EP300)
   04024 cAMP signaling pathway
    109559852 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109559852 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109559852 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109559852 (EP300)
   04935 Growth hormone synthesis, secretion and action
    109559852 (EP300)
   04919 Thyroid hormone signaling pathway
    109559852 (EP300)
   04916 Melanogenesis
    109559852 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    109559852 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559852 (EP300)
   05206 MicroRNAs in cancer
    109559852 (EP300)
   05203 Viral carcinogenesis
    109559852 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    109559852 (EP300)
   05215 Prostate cancer
    109559852 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109559852 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109559852 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559852 (EP300)
   05161 Hepatitis B
    109559852 (EP300)
   05164 Influenza A
    109559852 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559852 (EP300)
   05165 Human papillomavirus infection
    109559852 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109559852 (EP300)
   03036 Chromosome and associated proteins [BR:biu03036]
    109559852 (EP300)
   03029 Mitochondrial biogenesis [BR:biu03029]
    109559852 (EP300)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109559852 (EP300)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    109559852 (EP300)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109559852 (EP300)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    109559852 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 109559852
NCBI-ProteinID: XP_019817427
UniProt: A0A6P5BWC2
LinkDB
Position
5
AA seq 2411 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGVMSSPVSQPAMGMNTGMNAGMSPGMLT
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGSAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQMGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGMVAPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGSTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQPSNLLSDSMLHSAINS
QNPMMSDNGSVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMVPVMNTGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRVTPQPGLNQFGQMSM
PQPPIGPRQNSPLQHHVQLAQTGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTNM
PLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQSQVLHPPPRQTPTPPPTQLPPQVQPS
LPAAPSVDQAQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQTIPEKQPSQEVKMEPKMEVEAPEPAXTQPEDXPETKAEDCKVEPTETEERGTELK
TETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMSTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFSYLSLSPSPFEESIERERECVGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPTTPQTPQPPPPSQPQPTPPNNMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPL
PGPPPAAVEVAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPGG
HLEPGMGPTGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVSQHGQPLNMPPQPGLGQVGV
SPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQ
PLPGQPGLQPPAMPGQQGVHSSPAMQNLNPMQAGVPRAGLPQQPTQQQQLPPPMGGMSPQ
AQQMNMNHSTMPSQFRDILRRQQMMQQQQQGAGPGMGPGLANHNQFQPPQGVGYPAPQQQ
PPPRMQHHMQQIPQGSMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQ
HMLPSQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQ
TSSPHPGLVAAQGNPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLGTDNSDLN
SNLSQSTLDIH
NT seq 7236 nt   +upstreamnt  +downstreamnt
atggccgagaatgtcgtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacag
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaagcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcccaggcaggcttgacttctcccaacatggggatgggcact
agtgggccaaatcagggccccacgccgtctgcaacaggtgtgatgagcagtcccgtcagt
cagcctgccatgggaatgaacacggggatgaacgctggcatgagtcccggcatgctgact
gccggcaatggacaagggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgaccgaatatgcagtacccgaacccaggcatgggaagtgctggcaacttaatg
actgagccgctgcagcaaggctctccccagatggggggacagacgggactgagaggcccc
cagcctctcaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagatgggagccagtggccttggtctccagattccgacaaagtctgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggctgttcctggtggaggaatg
cccaatatgggccagcagcaggccccacaggtccagcagccaggcatggtggctccggtg
gcccaggggatgggttctggggcacatacggctgatccggagaagcgcaagctcatccag
cagcagcttgtcctcctcctgcacgctcacaagtgccagcgccgggagcaggccaacggg
gaggtgaggcagtgcaaccttccccactgtcgaaccatgaagaacgtcctaaaccacatg
acacactgccagtcgggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcccactggaagaattgtacaaggcatgattgtcctgtgtgtctccccctgaaaaac
gctggagataagagaaatcaacagtcaattttgactggagcaccagttggacttggcagt
actagctctctaggggtgggtcaacagtccactcccagcctaagcactgtcagtcagatt
gatcccagctctatagaaagagcctatgcagcccttggactgccctatcaagtaaatcag
atgccgacccagccccaggtgcaagcgaagaatcagcagaaccagcagtctgggcagtct
ccccaagggatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaccgtcgaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccaatgatgagtgacaatggcagtgtggcctctctgggtcctatgccaacagca
gctcaaccatccagtactggaattcggaagcaatggcatgaagatattactcaggatctt
cgaaatcatcttgtccacaaactcgttcaagccatatttcccactccggatcctgctgct
ttaaaagacagacggatggaaaacctagttgcatatgcccggaaagtggaaggggacatg
tatgaatcggcaaacaatcgagcggaatactaccacctgctagctgagaagatctataag
attcagaaggaactagaagaaaagcgaaggactagactacagaaacagaacatgctacca
agtgctgcaagcatggtgccagttatgaacacagggcctaacatggggcagccacaacca
ggaatgacttctaatggccctctccctgatccatctatgatccgcggcagtgtgccaaac
cagatgatgcctcgggtaactccacagcctggtttgaatcagtttggccagatgagtatg
cctcagccccctattggaccccggcaaaactctcctcttcagcaccatgtacagttagct
caaactggaacacttaacccgcctatgggctatgggcctcgcatgcagcagccttccagc
cagagccagtttcttcctcagactcaattctcaacacagggaatgaatgtaacaaatatg
cctttggctccgtctggcggtcaagcaccagtgtctcaagcacagatgtccagttcttcc
tgtcctgtgaactctcctataatgcctcctgggtctcaagggagccacattcactgtccc
cctctccctcaaccagctctgcatcagaactcaccctcacccgtacctagtcgcaccccc
acccctcaccacactccccctagcataggggctcagcagccaccagcaacagcaatccca
gcccctgttcctacgcctccagccatgccacctggcccacagtcccaggttctccatccg
cctccaagacagacgcctacgccgccaccaacacaacttcctccccaagtgcagccttcg
cttcctgctgctccctcagtcgaccaggcgcagcagcagcctctgtcccagcaaagcaca
gcagcctctgtgcccaccccgacggcacccctgctgcctccgcagccggcaactccactt
tcccagccagctgtaagcatcgaagggcaggtatcaaaccctccatccactagtagcacg
gaagtgaattctcagaccattcctgagaagcagccttcacaggaagtaaaaatggagcct
aaaatggaagtggaggcaccagaaccagcagakactcagccggaggatrttccagagact
aaagcagaagactgtaaagtagaacctacagaaaccgaagagagaggcactgaattaaaa
actgagacaaaagaggaagaagaccagccaagtacttcagcgacccagtcatctccagcc
ccaggacagtcaaagaagaagattttcaaacctgaagagttacgacaggcactgatgtca
acactggaggcactttaccgacaggatccggaatcccttcccttccgtcagcctgtggac
cctcagcttctaggaatccctgattactttgatattgtgaagagccctatggatctttct
accatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggatgac
atttggctcatgttcaacaatgcttggttatataatcggaaaacatcacgggtgtacaaa
tactgctccaagctgtctgaggtcttcgaacaagaaattgaccctgtcatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactctgttgctatggcaaa
cagttatgcacaatccctcgtgatgccacttactacagttatcagaacaggtatcatttc
tgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcc
caacctcaaactacaataaataaagaacaattttcaaagagaaaaaatgacactctggat
cctgaactgtttgttgagtgtacagagtgtgggagaaagatgcatcagatctgtgtcctc
catcacgagatcatctggccatcgggatttgtctgtgatggttgtttaaagaagactgca
cgaactagaaaagaaaataagttttctgctaaaagactgccatctaccaggcttgggaca
tttctggagaatcgtgtgaatgagtttctgaggcgacaaaatcaccctgagtcaggagag
gtcactgttcgagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatgaaa
gcaagatttgtagatagtggagagatggcagaatccttttcttatctatctctctccccc
tctcccttcgaagagtctatagagagagagagagagtgcgttggtatgcacgttcaagag
tatggctctgactgccctccgcccaaccagaggagagtatacatatcatacctcgatagt
gttcacttcttccgtcctaaatgcttgaggactgccgtctatcatgaaatcctaattgga
tatttggaatatgtcaagaaattaggatacacaacagggcatatttgggcgtgtccgcca
agtgaaggagacgactacatcttccattgccacccccctgaccagaagatacccaagccc
aagcgactgcaggagtggtacaaaaagatgctcgacaaagctgtgtccgagcgaatcgtc
catgattataaggacattttaaaacaagctactgaagatcgattgacaagcgcgaaggaa
ttgccttactttgagggtgatttctggcccaacgtcctggaagagagcattaaggaactg
gaacaggaggaggaggagcggaagcgggaggagaacaccagcaacgagagcacagatgtg
acaaagggagacagcaaaaatgctaaaaagaaaaacaacaagaaaactagcaaaaacaag
agcagcctgagtcgtggcaataagaagaagccaggcatgcctaacgtatccaacgacctc
tcacagaaattgtatgccaccatggagaagcacaaagaggtcttctttgtgatccgtctc
atcgctggccctgccgccaactccctgcctcccatagttgaccccgaccccctcatcccc
tgtgacctgatggatgggcgggatgcctttctcacccttgcaagggacaagcacctggag
ttctcgtcgttgcgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacc
cagagccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagacacgc
tggcactgcaccgtgtgtgaggattatgacttgtgtatcacctgctacaacactaaaaac
cacgaccacaagatggagaagctcgggctggggcttgatgacgagagcaacaaccagcag
gctgccgccacgcagagcccgggagactcccgccgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgcccc
atctgcaaacagctcatcgccctgtgctgctaccatgccaagcactgccaggagaacaag
tgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctgcagcac
cggctccagcaggcccagatgctgcgcaggaggatggccagcatgcagcggactggtgtg
gtggggcagcagcagggcctgccctcccctacccctgccacccccaccacgccgacgggc
cagcagcccaccaccccgcagacaccccagcccccacccccctctcagccccagcccaca
cctcccaacaacatgccgccctacttgcccaggactcaagctgctggcccagtgtcccag
ggcaaggcagcaggccaggtgacgcccccgacccctcctcagactgctcagcccccactt
ccgggacccccacctgcagcagtggaggtggccatgcagattcagagggcagccgagacg
caacgccagatggcccacgtgcaaatctttcagcggccgatccagcaccagatgccgcag
atgactcccatggcccctatgggtatgaacccgccccccatggccagagggcctggtggg
catttggagccagggatggggcccactggcatgcagcagcaacccccatgggcccaggga
ggactgccccagccccagcagctgcagtcygggatgccccggccagccatgatgtcggtg
tcacagcacgggcagcccctgaacatgcctccccagccgggcctgggccaggtaggtgtg
agccctctcaagccaggcactgtgtctcaacaagccttacagaacctcctgcggactctc
aggtctcccagctcccccctgcagcagcaacaggtgctcagtatccttcatgccaacccc
cagctattggctgcgttcatcaaacagcgggctgccaagtacgccaactccaacccgcag
cccctccccgggcagccgggcctgcagccccccgctatgccaggtcagcagggggtccac
tccagccccgccatgcagaacttgaaccccatgcaggcaggtgtcccgagggctggcctg
ccccagcagcccacrcagcagcagcagctcccgccacccatgggcgggatgagcccacag
gctcagcagatgaacatgaatcacagcaccatgccctcgcaattccgagacatcttgagg
cgacagcagatgatgcagcagcagcagcagggagcggggccagggatgggcccggggctg
gccaaccacaaccagttccagcctccccagggcgtgggctaccctgccccgcagcagcag
ccgccaccgcgaatgcagcatcacatgcagcagataccacaagggagcatgggacagatg
ggccagctcccgcaggccctgggagcagaggcgggagccagtctgcaggcctaccagcag
cggctccttcagcaacagatgggctcgccggcccagcccaaccccatgagcccccagcag
cacatgctcccgagtcaggctcagtccccgcacctccaaggccagcagatcccgtctctc
tccaatcaagtgcgatctccccagcctgtcccttctccgcggcctcagtcccagcccccc
cactccagcccttccccacggatgcagcctcagccttctccacaccacgtctccccacag
accagttctccacatcctggactggtcgctgcccagggcaaccccatggaacaagggcat
tttgccagcccggaccagaattcgatgctctctcagctcgctagcaatccaggcatggca
aacctccatggtgcragcgccacggacctgggactcggcaccgacaactcagacttgaat
tcaaacctctcacagagtacactagacatacactag

KEGG   Bos indicus (zebu cattle): 109578349
Entry
109578349         CDS       T04792                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04024  cAMP signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04310  Wnt signaling pathway
biu04330  Notch signaling pathway
biu04350  TGF-beta signaling pathway
biu04520  Adherens junction
biu04630  JAK-STAT signaling pathway
biu04720  Long-term potentiation
biu04916  Melanogenesis
biu04919  Thyroid hormone signaling pathway
biu04922  Glucagon signaling pathway
biu04935  Growth hormone synthesis, secretion and action
biu05016  Huntington disease
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05211  Renal cell carcinoma
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109578349 (CREBBP)
   04330 Notch signaling pathway
    109578349 (CREBBP)
   04350 TGF-beta signaling pathway
    109578349 (CREBBP)
   04630 JAK-STAT signaling pathway
    109578349 (CREBBP)
   04066 HIF-1 signaling pathway
    109578349 (CREBBP)
   04068 FoxO signaling pathway
    109578349 (CREBBP)
   04024 cAMP signaling pathway
    109578349 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109578349 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109578349 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109578349 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    109578349 (CREBBP)
   04919 Thyroid hormone signaling pathway
    109578349 (CREBBP)
   04916 Melanogenesis
    109578349 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    109578349 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578349 (CREBBP)
   05206 MicroRNAs in cancer
    109578349 (CREBBP)
   05203 Viral carcinogenesis
    109578349 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    109578349 (CREBBP)
   05215 Prostate cancer
    109578349 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109578349 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109578349 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109578349 (CREBBP)
   05161 Hepatitis B
    109578349 (CREBBP)
   05164 Influenza A
    109578349 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109578349 (CREBBP)
   05165 Human papillomavirus infection
    109578349 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109578349 (CREBBP)
   03036 Chromosome and associated proteins [BR:biu03036]
    109578349 (CREBBP)
   03029 Mitochondrial biogenesis [BR:biu03029]
    109578349 (CREBBP)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109578349 (CREBBP)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    109578349 (CREBBP)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109578349 (CREBBP)
Mitochondrial biogenesis [BR:biu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    109578349 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 109578349
NCBI-ProteinID: XP_019843002
UniProt: A0A6P5E1G7
LinkDB
Position
25
AA seq 2435 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPAQQGLGGQAQGQPSSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHGLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQAGGMSKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFAADIKNASVTNVPNMPQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRSLNPLGNNPMNIPAGGITTDQ
QPSNLISESALPTSLGATNPLMNDSSNSGNIGTLSTIPAAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALSAPGTQPPGIPQAQPVRPPNGPMPLTVNRMQVSQG
MNSFNPISLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHA
NSMMAQAPAQSQFLPQSQFPSSSGALSVSSVGMGQPAAQAGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQPPLHQTPPPASTAAGMPSLQHPAAPGVTPPQPAAPTQPSTPASSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPP
GTPLSQTAASIDNRVPTPSSVASAETNSQQPGPEVPLLEMKAEIKTEDTEPDAGEPKGEP
GATMMEEDLQGSSQVKEETDPTEQKSEPMEVDEKKTEVKVEAKEEEEGSTNGTASQSTSP
SQPRKKIFKPEELRQALMSTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDILKQANEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRTNKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVIHTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HTHKMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPVSQMAPVGLNVPRPGQVSGPVVPTLPAGQWQQAPIPQQQPMPGMPR
PVMSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQAQPGLHQQPGLQNLNAMQASGPRPGVPPQQQAMGG
LNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQGSAGMAGGMA
GHSQFQQPPGPAGYPPAMPQQRMQQHLPMQGSAMGPMAAQMGQLGQMGQXGLGADSTPNI
QQALQQRILQQQQMKQQMGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPA
PVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSA
MLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7308 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgatttggaaaatgatctt
cctgatgagttgatccccaatggaggagaattaagccttttaaacagtgggaacctcgtt
ccagatgctgcttccaaacataaacaactgtccgagctcctgcgaggcggcagcagctcc
agcatcaacccgggaataggcaatgtgagtgccagcagccccgcgcagcaaggcctcggc
ggccaggcccaggggcagcccagcagtgccaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttccgcccccagcctgcctaagcaggcagccagcacc
tccgggcccactcctcctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaacgcaaac
ttcaaccagacccacccaggcctcctcaatagtaactctggccacggtttaatgaaccag
gcccagcaaggacaggcgcaggttatgaatggatctcttggggctgctggccgaggaagg
ggagctgggatgccataccctactccggccatgcagggggccacaagcagtgtgctggct
gagacgttgacccaagtttcaccgcaaatggccagtcatgcagggctgaacaccgcacag
gccggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcagatgggagcccctggagtgaaccctcagctgccgagcaag
cagagcatggtcaacagcttgcctccgtttgccgcagacatcaagaacgcttcagtcacc
aacgtgccaaacatgcctcagatgcaaacatcagtgggaattgtacccacccaggcgatt
gcaacgggccccaccgcagatcccgaaaaacgcaaactgatacagcagcagctggtccta
ctgcttcacgctcataaatgccagaggcgagaacaagccaatggagaggtccgggcctgc
gcactcccacattgtcggaccatgaaaaacgtcttgaatcacatgacgcattgtcaggct
gggaaggcttgtcaagttgcccattgcgcatcttcacgacaaatcatctctcattggaag
aactgcacacggcatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacaccattggttctgtt
ggcacaggccaacagaatgccacttctttaagtaacccaaatccgatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggagt
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccatcaaacttgatttcagaatcagctcttccaacttcccttggggctacaaacccc
ctgatgaatgacagctcaaactctggaaacattggcaccctcagcactatacctgcagca
gcacctccttccagcaccggagttcggaaaagctggcacgaacacgtcactcaggacctg
cggagccatctagtgcataaacttgtccaagccatcttcccgacacctgaccctgcagcc
ctgaaggatcgccgcatggagaacctggtggcctacgctaagaaagtggaaggggacatg
taygagtctgccaacagcagggatgaatactatcacttactagcagagaaaatctacaag
attcaaaaagagctagaagaaaagcggaggtcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttatcagcccccgggacrcagccccctggaataccccaggcgcagcct
gtgagacctccaaatgggcccatgcctcttacagtgaatcgtatgcaggtttctcaaggg
atgaattcatttaacccaatatccttggggaacgtacagttgccacaagcgcccatggga
ccgcgtgcggcatcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccgtcccgaatgcctcagcctccgaayatgatgggcgcgcacgcc
aacagcatgatggcccaggcgcctgcgcagagccagttcctcccgcagagccagttcccg
tcgtccagcggggcgctgagtgtgagcagcgtgggcatggggcagccggcggcgcaggct
ggcgttccacaggggcaagtgccaggggccgctcttcccaaccccctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagccgccgctgcatcagaccccg
cctcccgcctccacggccgccggcatgccgtctctgcagcacccagcagctcccggggtg
acgcccccccagccagctgcgcctacccagccttcaactcccgcgtcgtcttccgggcag
actcccaccccgactcctggctccgtgcccagcgccagccagacgcagagtactcctacg
gtccaggcagccgcccaggcccaggtgaccccgcagcctcagaccccagtgcagcctcca
tccgtggccaccccacagtcatcgcagcagcagccaacacctgtgcacacgcagcccccc
ggcaccccgctttcccagacagcagccagcattgataacagggtccccactccatcctca
gtggccagcgccgaaaccaactcccagcagccaggccccgaggtgccactgctggagatg
aaggccgagatcaagaccgaggacacagagcccgatgctggggagcccaagggagagcct
ggggctacgatgatggaggaggacttacaaggatcttctcaagttaaagaagaaacagac
ccgacagagcagaagtcagaaccaatggaagtggatgaaaagaaaactgaagtgaaggtc
gaagctaaagaggaagaagagggcagcaccaatgggacagcctctcagtccacgtcccct
tcgcagcctcgcaagaaaatcttcaagccggaggagttgcgccaggctctgatgtcaacc
ctggaagctctgtaccgacaggatccagagtccttaccctttcggcagcctgtggatccc
cagctcctgggaattccagattactttgacattgtgaagaatcccatggacctttccacc
atcaagcggaagctggatacagggcagtaccaggagccctggcagtatgtagacgacgtc
tggctcatgttcaacaacgcctggctttacaatcggaagacatcccgggtctacaagttc
tgcagcaaacttgcagaggtctttgagcaggagattgaccccgtcatgcagtcccttggg
tattgctgtggacgcaagtatgagttttccccacagactctgtgctgctatgggaagcag
ctgtgtacaattcctcgagatgctgcctactacagctatcagaataggtatcacttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaa
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaaccttttgttgactgcaaggagtgtggccggaagatgcatcagatttgtgttctccac
tacgacatcatctggccctcaggttttgtatgtgacaactgcttgaagaaaacgggcaga
actcgaaaagaaaacaaattcagtgctaaragactacagaccacacggttgggaaaccac
ctggaagaccgagtcaacaagtttttgcggcgacagaatcaccctgaagctggcgaggtg
tttgtccgtgtggtggccagctcagacaagacagtggaggtcaagccagggatgaagtca
cggttcgtggattctggggagatgtcggagtctttcccatacagaaccaaagcactcttt
gcctttgaggagattgacggggtggacgtgtgcttctttgggatgcacgtccaggagtac
ggctctgactgccccccgccaaacacaaggcgtgtgtacatatcttatctggacagtatt
catttcttccgaccccgatgcctccgaacagccgtttaccatgagatccttattggatat
ttagagtatgtgaagaaattggggtatgtgacagggcacatctgggcctgtcccccgagt
gaaggagatgactacatcttccactgccacccccctgatcaaaaaatccccaagccgaag
cgcctgcaagagtggtataagaagatgctggacaaggccttcgccgagcgcatcatccat
gactacaaggacattttgaaacaagcaaatgaagacaggctcaccagcgccaaggagctg
ccctactttgagggggacttctggcctaacgtgctggaggagagcattaaggagctggag
caggaggaggaagagaggaagaaggaggagagcaccgcggccagcgagaccacagagggc
agccagggcgacagcaagaacgccaagaaaaagaacaataagaaaaccaacaagaataaa
agcagcatcagccgcaccaacaagaagaagcccagcatgcccaacgtgtccaacgacctg
tcccagaaactctacgccaccatggagaagcacaaagaggtcttctttgtgatccacctc
catgctgggcccgtcatccatacgctgccccccatcgtcgaccctgaccccctgctcagc
tgtgacctcatggacgggcgggatgccttccttacgctggcccgggacaagcactgggag
ttttcctccttgcggcgctccaagtggtccacgctgtgcatgctggtggagctgcacacc
cagggtcaggaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtgtgcgaggactacgacctctgcatcaactgctacaacacgaagagc
cacacccacaagatggtgaagtgggggctgggcctcgacgacgagggcggcagccagggc
gagccgcagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaacgccaactgctcactgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgcccg
gtgtgcaagcagctcattgccctctgctgctaccacgccaaacactgccaagaaaacaag
tgccccgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagcctgccttcccctacctcagcgccgcccgggacccccacgcagcagccc
agcacgccccagacgccgcagccccccgcccagccccagccctcgcctgtgagcatgtca
ccagccggcttccccagcgtggcccggactcagccacccacgacggtgtccaccgggaag
cccaccaaccaggtgcccgccccgccgccccccgcccagcccccacccgcggcggtggag
gcggcccggcagatcgagcgggaggcccagcagcagcagcacctgtaccgggtgaacatc
aacaacggcatgcccccggggcgcacgggcatggtgaccccggtgagccagatggccccc
gtgggcctgaacgttccccggcccggccaggtcagcgggcccgtcgtgcccaccctgcca
gccgggcagtggcagcaggcgcccatcccccagcagcagccgatgccgggcatgccccgg
cccgtgatgtccatgcaggcccagccagccgtggccgggccccggatgtccggtgtgcag
ccgccccggagcatctcgcccggcgccctccaggacctgctgcggaccctgaagtcgccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatg
gcagctttcatcaaacagcgcacggccaagtacgtggccagccagcccggcctgcagcca
cagcctggcctccaggcccagcccggcctgcaccagcagcccggcctgcagaacctgaac
gccatgcaagccagcgggccgcggcctggcgtgcctccgcagcagcaggccatgggtggc
ctgaacccccagggccaagccctgaacatcatgaacccgggccacaaccccagcatggcg
agtatgaacccgcagtaccgagagatgctgaggaggcagctcctgcagcagcagcagcag
caacagcagcagcaacagcagcagcagcagggcagcgccggcatggccgggggcatggca
gggcacagccagttccagcagcccccaggccccgcgggctacccccctgccatgccgcag
cagcggatgcagcagcacctccccatgcagggcagygccatgggcccgatggcggctcag
atggggcagctcggccagatggggcagcnngggctgggcgcagacagcacccccaacatc
cagcaggccctgcagcagcggattctgcagcagcagcagatgaagcagcagatggggtcc
ccgggccagccgaaccccatgagcccccagcagcacatgctctcaggacagcctcaggcc
tcgcacctccccggccagcagatggccacatccctcagtagccaggtgcggtctccggcc
cctgtccagtctccgcggccccagtcccagcctccacattccagcccgtcgccacggata
cagccccagccttcaccgcaccacgtctcgccccagactggttccccccacccaggactc
gcagtcaccatggccagctccatagatcagggacacttggggaaccccgaacagagtgca
atgctcccgcagctgaacacccctaaccggagtgcgttgtccagtgagctgtccctggtc
ggcgacaccacgggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system