KEGG   Bos indicus (zebu cattle): 109560175
Entry
109560175         CDS       T04792                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04390  Hippo signaling pathway
biu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109560175 (AREG)
   04012 ErbB signaling pathway
    109560175 (AREG)
   04390 Hippo signaling pathway
    109560175 (AREG)
   04151 PI3K-Akt signaling pathway
    109560175 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    109560175 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109560175 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109560175 (AREG)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Others
   109560175 (AREG)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109560175 (AREG)
SSDB
Motif
Pfam: EGF Laminin_EGF
Other DBs
NCBI-GeneID: 109560175
NCBI-ProteinID: XP_019817718
UniProt: A0A6P5BWP7
LinkDB
Position
6
AA seq 247 aa
MRAPLLPPAPVVLSLLIFGSAHYTAGLDVNDTYSGKGEPFSGDHSADRFEVTSRSEISSA
SETPPGGELSSXIDYDYAEEYDNEPQISGYIVDDSVRVEQVVKPKKNKTESEKTSDKPKR
KKKGGKNGKNRRNRKKKNLCDTEFQNFCIHGKCTFLEQLETVSCQCYPEYFGERCGEKSM
KTQSMVDSDLSKIALAAIAAFVSAMTFTAIAVFITILLRRRYLRGYEGVAEERKKLRQEN
GNAHAVA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagagccccgctgctgccgccggcgcccgtggtgctgtcgctcctcatctttggctca
gcccattatactgctggattagacgtcaatgacacctactctggaaaaggggaaccattt
tctggggaccacagtgctgacagatttgaggtgacctcaagaagtgagatttcctctgca
agtgaaacgcctcctggtggcgaactgtcctccgwgatcgactatgactatgcagaagag
tatgataatgaaccacagatatctggctatattgtagatgattcagtcagagttgaacag
gtagttaagcctaagaaaaacaaaacggaaagtgaaaagacttcagataaacccaagaga
aagaaaaagggaggcaaaaatggaaaaaatagaagaaacagaaagaagaaaaatctgtgt
gatacagaatttcaaaatttctgcattcatggaaaatgtacatttttagagcaactggaa
acagtatcatgccaatgttatccagagtactttggtgaacgatgtggggaaaagtccatg
aagactcagagcatggtcgacagcgatttatcaaaaattgctttagcagctatagctgct
ttcgtctctgccatgaccttcacagctattgctgtttttattacaatcctgcttcgaaga
cgatacctcaggggatatgaaggtgtcgctgaagaacgaaagaaacttcgacaagaaaat
ggaaatgcacaygctgtagcataa

DBGET integrated database retrieval system