KEGG   Bos indicus (zebu cattle): 109560207
Entry
109560207         CDS       T04792                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04152  AMPK signaling pathway
biu04218  Cellular senescence
biu04914  Progesterone-mediated oocyte maturation
biu05161  Hepatitis B
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109560207 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109560207 (CCNA2)
   04218 Cellular senescence
    109560207 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109560207 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560207 (CCNA2)
   05202 Transcriptional misregulation in cancer
    109560207 (CCNA2)
   05203 Viral carcinogenesis
    109560207 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109560207 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109560207 (CCNA2)
   05161 Hepatitis B
    109560207 (CCNA2)
   05169 Epstein-Barr virus infection
    109560207 (CCNA2)
   05165 Human papillomavirus infection
    109560207 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109560207 (CCNA2)
   03036 Chromosome and associated proteins [BR:biu03036]
    109560207 (CCNA2)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109560207 (CCNA2)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109560207 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109560207
NCBI-ProteinID: XP_019817754
UniProt: A0A6P5BWT7
LinkDB
Position
6
AA seq 430 aa
MLGSSAHGPAAREAGSAVTLQQTAFQEDQENVNPEKAAPAQQPRTRAGLAVLRAGNSRGP
APQRPKTRRVAPLKDLPINDEYVPVPPWKANNKQPAFTIHVDEAEEEIQKRPTESKKSES
EDVLAFNSAVTLPGPRKPLAPLDYPMDGSFESPHTMEMSVVLEDEKPVSVNEVPDYHEDI
HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRF
LSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVL
AFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHL
ALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVS
LLNPPETLNV
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgttgggcagctccgcgcacgggcctgcggcccgcgaggcgggttcggcggtaacattg
cagcagacggcgttccaggaggaccaggagaacgtcaatcccgagaaggcggcgcccgcc
cagcagccccggacccgggctggactggcggtactgagggccggaaactcgcggggtcca
gctccccagaggcctaagacgcgacgggttgcacctcttaaggatcttcctataaatgat
gagtatgtccctgttcctccctggaaagcaaacaataaacagcctgcatttaccatacat
gtggatgaagcagaagaagaaattcaaaagaggccaactgaatctaaaaaatcagaaagt
gaagatgtcttggcctttaattcagctgttactttaccaggaccaagaaagccactggca
cctcttgattacccaatggatggtagttttgagtctccacatactatggaaatgtcagtt
gtattggaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgaggacatt
cacacgtaccttagggaaatggaggttaaatgtaagcctaaagtgggttacatgaagaaa
cagccagacattactaacagtatgagggctatcctcgtggactggttagttgaagtagga
gaagaatataaactgcagaacgagaccctgcatttggctgtgaactacattgataggttt
ctttcatccatgtctgtgttgagaggaaaacttcaacttgtgggcactgctgctatgctt
ttagcctcaaagtttgaagagatatacccgccagaagtagcagagtttgtatacattaca
gatgacacttataccaagaaacaagttctaaggatggagcacctagtcttgaaagtcctg
gcttttgacttagctgcaccaacaataaatcagtttcttacccagtactttttgcatcag
cagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagagttaagtttgata
gatgctgacccatatctaaagtatttgccgtcagttatcgctgcagcagcctttcattta
gcactctacacagtcacaggacaaagctggcctgaatcattagtacagaagactggatat
actctggaaactctaaagccttgtctcctggaccttcaccagacctacctcagagcacca
cagcacgcacaacagtcaataagagagaagtacaaaaattcaaagtatcatggtgtttct
ctcctcaacccaccagagacactaaatgtgtaa

KEGG   Bos indicus (zebu cattle): 109566776
Entry
109566776         CDS       T04792                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04152  AMPK signaling pathway
biu04218  Cellular senescence
biu04914  Progesterone-mediated oocyte maturation
biu05161  Hepatitis B
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109566776 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109566776 (CCNA1)
   04218 Cellular senescence
    109566776 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109566776 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566776 (CCNA1)
   05202 Transcriptional misregulation in cancer
    109566776 (CCNA1)
   05203 Viral carcinogenesis
    109566776 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109566776 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109566776 (CCNA1)
   05161 Hepatitis B
    109566776 (CCNA1)
   05169 Epstein-Barr virus infection
    109566776 (CCNA1)
   05165 Human papillomavirus infection
    109566776 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109566776 (CCNA1)
   03036 Chromosome and associated proteins [BR:biu03036]
    109566776 (CCNA1)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109566776 (CCNA1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109566776 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 109566776
NCBI-ProteinID: XP_019826953
UniProt: A0A6P5CLE6
LinkDB
Position
12
AA seq 421 aa
MHLSSSKSGVVLAPVSRGPDACQMITRGQLGQDPPQRTVLGVLTENGQYRRTCGQELTTL
RCFSGSENVYPPAGKKALSDSRVQAPAKQGFDIYMDEPEQGNRDSCPGRKGMALEDAYEV
DTSALKSDLHFLLDFNTVSPMLVDSSLHSQSEDASDFGTDVINVTEYAEEIHQYLREAEI
RHRPKAHYMRKQPDITESMRTILVDWLAEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFW
PETLATFTGYSLTEIVPCLSELHKTCLSIPHRPQQAIREKYKASKYMHVSLMEPPMVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcatctcagcagctccaagagtggagtagtgctggctccagtgtcccgaggtcctgat
gcctgtcagatgataaccagaggccagttgggccaggatccgccacaaagaacagtacta
ggagtgctaactgagaatgggcagtaccggaggacctgtggccaggagctcaccacactc
aggtgtttctctggatcagaaaatgtctaccctccagctggaaagaaagcgctgtctgac
agtagggttcaggcacctgccaagcaaggatttgacatctacatggatgagcctgaacag
gggaacagagatagctgcccagggcgaaaggggatggcattagaggatgcgtatgaagta
gacaccagcgcactcaagtcagaccttcacttcctgttggattttaacacagtttcccct
atgctggtagattcatctctccactctcagtctgaagatgcatcagattttggtacagat
gtgataaatgtgactgaatatgctgaagaaattcatcagtaccttagagaagctgaaatc
agacacaggcccaaggcacactacatgaggaaacaaccagacatcacagaaagcatgcgg
accattctggtggactggctggctgaggtcggagaagagtacaagctccgcgcagagacc
ctctacctggctgtcaacttcctggacaggtttctttcctgcatgtctgttcttagaggg
aaactgcagcttgtaggaacagcagctattctcctggcttcaaaatatgaagaaatatat
ccacccgaagtagatgagtttgtctacataacggatgatacctacacaaaacgacaactg
ctgagaatggaacacctgctgctgaaggtcctggcttttgatctgacagtgccaactacc
aaccagttcctccttcagtacttaaggaggcaaggagtgtgcatcaggactgagaacctg
gccaagtatgtagcagaactgagtctccttgaagctgacccgttcttgaaataccttcct
tcactgatagctgcagctgcttattgcctggcaaactacactgtgaacaggcacttctgg
ccagaaaccctcgccacatttacaggctattcattaactgaaatcgtgccttgcctgagt
gagctacataaaacgtgcctcagtataccccatcgacctcagcaagcaatcagggagaag
tacaaggcttcaaagtacatgcacgtgtctctcatggagccacccatggtgcttcctctg
cagtga

KEGG   Bos indicus (zebu cattle): 109568476
Entry
109568476         CDS       T04792                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04115  p53 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04934  Cushing syndrome
biu05161  Hepatitis B
biu05162  Measles
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05215  Prostate cancer
biu05222  Small cell lung cancer
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109568476 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109568476 (CCNE2)
   04114 Oocyte meiosis
    109568476 (CCNE2)
   04115 p53 signaling pathway
    109568476 (CCNE2)
   04218 Cellular senescence
    109568476 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568476 (CCNE2)
   05206 MicroRNAs in cancer
    109568476 (CCNE2)
   05203 Viral carcinogenesis
    109568476 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    109568476 (CCNE2)
   05215 Prostate cancer
    109568476 (CCNE2)
   05222 Small cell lung cancer
    109568476 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109568476 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109568476 (CCNE2)
   05161 Hepatitis B
    109568476 (CCNE2)
   05162 Measles
    109568476 (CCNE2)
   05169 Epstein-Barr virus infection
    109568476 (CCNE2)
   05165 Human papillomavirus infection
    109568476 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109568476 (CCNE2)
   03036 Chromosome and associated proteins [BR:biu03036]
    109568476 (CCNE2)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109568476 (CCNE2)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109568476 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109568476
NCBI-ProteinID: XP_019829355
UniProt: A0A6P5CUI0
LinkDB
Position
14
AA seq 404 aa
MSRRSSRLQAKQQPQASQTDSPQEAQIIQAKKRKTAQDVKKRKEEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPELSWGCSQDVWLNMLKK
ETRYVHDKHFEVLHSELEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELAILKALKWELCP
VTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPAKLKIFKKISMEDRHNIQTH
TNYLAMLDEVNYVNTFRKEGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacagcagccccaggccagtcagacggat
tccccgcaagaagcccagataattcaggccaagaagaggaaaacggcccaggatgtcaaa
aaaagaaaagaggaggtcaccaagaaacatcagtatgaaataaggaattgttggccgcct
gtattatcaggggggatcagtccttgcattatcattgaaacaccccacaaagaaatagga
acaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttacctgaattaagctggggatgttcacaagatgtttggctaaacatgttaaaaaaa
gagaccagatatgttcacgacaaacattttgaagttctgcattctgagttggaaccacag
atgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactgattggaattacctcattattcattgcttccaaacttgag
gaaatctacgctcctaagctccaagagtttgcttatgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaacttgctatattaaaggctttaaaatgggaactttgtcct
gtaacggtcatctcctggctaaatcttttcctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaaagttcattcaaattgctcagcttttagat
ctgtgtattttagccatcgattcattagagttccagtacagaatactggctgctgctgcc
ttatgccactttacctctattgaagtggttaagaaagcctcaggtttggaatgggacaac
atttctgaatgtgtagactggatggtaccttttgtcagtgtagtaaaaagtactagccca
gcgaagcttaagatttttaagaagatttctatggaagacagacacaacatacagacacat
acaaattatctggctatgctggatgaagtaaattatgtaaacaccttcagaaaggaggga
cagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

KEGG   Bos indicus (zebu cattle): 109572914
Entry
109572914         CDS       T04792                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04115  p53 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04934  Cushing syndrome
biu05161  Hepatitis B
biu05162  Measles
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05215  Prostate cancer
biu05222  Small cell lung cancer
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109572914 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109572914 (CCNE1)
   04114 Oocyte meiosis
    109572914 (CCNE1)
   04115 p53 signaling pathway
    109572914 (CCNE1)
   04218 Cellular senescence
    109572914 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572914 (CCNE1)
   05206 MicroRNAs in cancer
    109572914 (CCNE1)
   05203 Viral carcinogenesis
    109572914 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    109572914 (CCNE1)
   05215 Prostate cancer
    109572914 (CCNE1)
   05222 Small cell lung cancer
    109572914 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109572914 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109572914 (CCNE1)
   05161 Hepatitis B
    109572914 (CCNE1)
   05162 Measles
    109572914 (CCNE1)
   05169 Epstein-Barr virus infection
    109572914 (CCNE1)
   05165 Human papillomavirus infection
    109572914 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:biu03032]
    109572914 (CCNE1)
   03036 Chromosome and associated proteins [BR:biu03036]
    109572914 (CCNE1)
DNA replication proteins [BR:biu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    109572914 (CCNE1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    109572914 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109572914
NCBI-ProteinID: XP_019835641
UniProt: A0A6P5DBN5
LinkDB
Position
18
AA seq 411 aa
MPREKERDAKEPDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKIDRTVRSQCGSQP
WDSNRACENPCSLIPTPDKEEDELLYPHAAYKPQRSTPSSSRASPLPVLNWANREEVWKI
MLNKEKTYLRDKHLMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT
QQNVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELIIMKALKW
HLSPLTIVSWLNVYMQVAYLNDVYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFSYGVL
AASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAIVIRETGSSKLKHFRGVPAEDAHN
IQTHINSLDLLDKAQAKKAILSEENRISPLPTGVLTPPQSSKKQSSGQGSA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgccgagggagaaggagagggatgcgaaggaaccggataccatgaaagaggaaagtggc
accgatgtctctgttcgctccaggaaaagaaaggcaaatgtagccgtttttttgcaggat
cccgatgaagaaattgccaaaattgacaggactgtgagaagccagtgtggcagtcagcct
tgggacagtaatagagcctgtgaaaacccctgctccctgattcccacacctgacaaagaa
gaagatgaacttctgtacccacacgctgcgtacaagcctcagaggagcacgccgtcgtca
tccagagcgtcgccactgcctgtactgaactgggcaaatagagaggaagtatggaaaatc
atgttaaacaaggaaaagacatacttgagggacaagcaccttatgcaacggcaccctctt
ctgcagcctaaaatgcgagcaattcttctggattggttaatggaggtatgtgaagtctat
aaacttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaaca
caacaaaatgttgtaaaaacacttttacaacttattgggatttcatctttatttattgct
gccaaacttgaggaaatctatcctccaaagttgcaccagtttgcttatgttacagatggg
gcttgttcaggagatgaaattctcaccatggaattaatcattatgaaggcccttaagtgg
catttaagtcccctgaccattgtgtcctggttgaatgtatacatgcaggttgcatatcta
aatgatgtttatgaagtgctcctgcctcagtatcctcagcaaatcttcatacagattgca
gagcttttagatctctgtgtcctggatgtcgggtgcttagaattttcttatggtgtactt
gctgcttccgccttgtatcatttctcttcatctgaactgatgcaaaaggtttcagggtat
cagtggtgtgatatagagaagtgtgtcaagtggatggttccatttgccatagttataagg
gagacaggaagttcaaaacttaagcacttcaggggagttcctgctgaagatgcacacaac
atccagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccata
ttatctgaagaaaacaggatttctcctctccccactggagtcctcacccctccacagagc
agtaagaagcagagcagygggcagggatcagcatga

DBGET integrated database retrieval system