KEGG   Bos indicus (zebu cattle): 109560217
Entry
109560217         CDS       T04792                                 

Gene name
TF
Definition
(RefSeq) serotransferrin isoform X1
  KO
K14736  transferrin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04066  HIF-1 signaling pathway
biu04216  Ferroptosis
biu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109560217 (TF)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    109560217 (TF)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    109560217 (TF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109560217 (TF)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109560217 (TF)
  Exosomal proteins of colorectal cancer cells
   109560217 (TF)
SSDB
Motif
Pfam: Transferrin Phosphonate-bd
Other DBs
NCBI-GeneID: 109560217
NCBI-ProteinID: XP_019817780
UniProt: A0A6P5BXB0
LinkDB
Position
1
AA seq 510 aa
MRLVICSLLCAGALGLCLAVPERTVRWCTVSNLEASKCYSFHDNMKKVLSVEXPHVTCVK
RTSYLDCIRAIAAHEADAVMVDGGLVYEAGLKPYNLKPVVAEFYGSKDDPQTHHYVVAVV
KKGSNFQLNQLQGKKSCHTGLGWSAGWNIPMRMLLPSDWSQXAAAKFFAGSCVPCAXQXN
FPXLCQLCAGKGMDKCACSHXEPYFGYSGAFKCLQDGVGDVSFVRHLTVFENLANQADRD
QYELLCRENTRRPVHEYKGCHLARVPSHAVVARSVDGKEDLIWELLSQAQEHFGKDKSAE
FQLFYSPHGKDLLFTDXAIGFLRVPPKMDAKLYLGYEYFSVIQHLGRAIPEAEDPQRVMW
CTVGHDEHVKCNRWSALSGGILACTVEESTEDCIAAIAKGEADAMSLDGGFIYTAGKCGL
VPVLAENYLSQDGKEQLGSKCVNTPMKGYYVVAVVKKSDANLTWNSLRGKKSCHTAVGTS
AGWNIPMGFLYNQTGSCKLGKCVLSGGVPM
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgaggctcgtcatctgctccctgctgtgcgcgggcgccctggggctgtgtctggctgtc
cctgagagaactgtgagatggtgcactgtctcgaatcttgaggcgagtaagtgctacagt
ttccacgacaatatgaaaaaagtcctttcagtggaargtcctcatgtcacctgtgtgaag
agaacctcttaccttgattgcatcagggccattgcggcacacgaagcagatgctgtgatg
gtggatggcggtttggtctatgaggcaggtctgaagccctacaacctgaagcctgtcgtg
gcagagttctatgggtcaaaagatgatccrcagactcaccattatgtcgtagctgtggtg
aagaagggcagcaacttccagctgaatcagctccagggcaagaagtcctgccacacaggc
ctggggtggtctgctgggtggaacatccccatgaggatgcttcttccctctgactggtcc
caaraagcagcggccaagttcttcgcgggcagctgcgtcccctgtgcrsatcagtygaac
ttccccaractgtgccaactgtgtgctggaaaagggatggacaagtgtgcctgctcccac
crcgaaccgtacttcggctactcgggggctttcaagtgtctgcaggatggtgtgggggac
gtgagcttcgtgaggcatctgacggtatttgagaacctggctaaccaggccgacagggac
cagtaygaactgctctgcagggaaaacacccggaggcctgtgcacgagtacaaggggtgc
cacctggcccgggtcccttcccatgctgtcgtggcccgaagtgtggatggcaaagaagac
ttgatctgggagcttctcagtcaggctcaggaacactttggaaaagacaagtcagcagaa
ttccagctcttctactctcctcatgggaaagacctgctatttacagatkctgccattggg
tttttaagagtcccacctaagatggatgccaagctatacttgggatatgaatatttttcg
gtcattcagcatctggggagagcgatcccagaggcagaagatccccagagggtgatgtgg
tgcacagtgggccatgatgagcatgtcaagtgtaaccggtggagtgcgctgagcggcggc
atcttggcgtgcaccgtggaggagagcaccgaggactgcattgctgccattgcgaaagga
gaggctgacgccatgagcttggatggaggcttcatctacacagcgggcaagtgtggtctg
gtgcctgtcctggcagagaactacttgtctcaagatggcaaagagcagcttgggtctaag
tgtgtgaacacacctatgaaaggttattacgttgtggcagtggtcaagaagtcagatgcc
aacctaacctggaactctctgcgaggcaagaagtcctgccacactgcagttggcacttct
gctggctggaacatccccatgggtttcctatacaatcagactgggtcatgtaaattgggt
aagtgtgttctgagtggcggtgtgcctatgtag

DBGET integrated database retrieval system