KEGG   Bos indicus (zebu cattle): 109560323
Entry
109560323         CDS       T04792                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu03013  RNA transport
biu04066  HIF-1 signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04211  Longevity regulating pathway
biu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109560323 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109560323 (EIF4E)
   04151 PI3K-Akt signaling pathway
    109560323 (EIF4E)
   04150 mTOR signaling pathway
    109560323 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109560323 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    109560323 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109560323 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109560323 (EIF4E)
   03012 Translation factors [BR:biu03012]
    109560323 (EIF4E)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     109560323 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     109560323 (EIF4E)
Translation factors [BR:biu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    109560323 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 109560323
NCBI-ProteinID: XP_019817975
UniProt: A0A6P5BXW1
LinkDB
Position
6
AA seq 217 aa
MATVEPETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactccgaatcccccgcctacagaagaagag
aaaacagaatctaatcaggaggttgctaacccagaacactatattaaacaccctttacag
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cgattgatctctaagtttgatactgttgaagacttttgggctctgtacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacgatggctaattacactgaacaaacag
cagagacgaagtgacctcgatcgtttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggagctgttgttaatgttagagctaaaggt
gataaaatagcaatatggactactgaatgtgaaaacagagaagctgttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

KEGG   Bos indicus (zebu cattle): 109560989
Entry
109560989         CDS       T04792                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu03013  RNA transport
biu04066  HIF-1 signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04211  Longevity regulating pathway
biu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109560989 (EIF4E1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109560989 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    109560989 (EIF4E1B)
   04150 mTOR signaling pathway
    109560989 (EIF4E1B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109560989 (EIF4E1B)
  09149 Aging
   04211 Longevity regulating pathway
    109560989 (EIF4E1B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109560989 (EIF4E1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109560989 (EIF4E1B)
   03012 Translation factors [BR:biu03012]
    109560989 (EIF4E1B)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     109560989 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     109560989 (EIF4E1B)
Translation factors [BR:biu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    109560989 (EIF4E1B)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 109560989
NCBI-ProteinID: XP_019818984
UniProt: A0A6P5C071
LinkDB
Position
7
AA seq 247 aa
MEWRLRQRLRQVDAQARLGWAWAEEAEDGIQKWKKEDEKEEEEAGAGPCMGEEALRKTPE
EGKPDLHPLLNRWALWFFKNDRSRAWQNNLHRVTKFNTVEDFWAIYNNIQLASKLSSGCD
YALFKDGIKPMWEDSRNKRGGRWLVSLTKQQRHIELDHLWLETLLCLIGESFGEHSQEVC
GAVINIRAKGDKIAVWTREAENQEGVLHIGRVYKERLGLSTKTIIGYQAHADTATKSNSL
AKNKFVV
NT seq 744 nt   +upstreamnt  +downstreamnt
atggagtggcggctgcggcagaggctgcggcaggtggacgcacaggctcggctgggctgg
gcctgggctgaagaggctgaggatgggatccaaaagtggaagaaagaggatgagaaagag
gaggaggaggcaggcgcggggccgtgcatgggagaggaggctctgaggaagaccccggag
gagggcaagccggacttacacccgctgctcaacaggtgggctctgtggttcttcaagaat
gaccgcagccgagcctggcagaacaacctgcatcgggtcaccaagttcaacaccgtggag
gacttctgggcgatatataataatatccagctggccagtaagctctcttccggctgtgac
tacgccctgttcaaggatggcattaagcccatgtgggaagacagcaggaataagcggggt
ggccgctggctggtcagcctcacaaagcagcagcgccacattgagctggaccacctgtgg
ctggagacactgctgtgtctcatcggggagagctttggggagcacagccaggaagtatgt
ggggccgtcatcaacatccgagccaagggggacaagattgctgtgtggacacgggaggca
gagaaccaggarggcgtgctacacattgggcgtgtctacaaagagcgcctgggcctctcc
acaaagaccatcattgggtaccaggcccacgcagacacagccaccaagagcaactcctta
gccaagaacaaatttgtggtgtga

KEGG   Bos indicus (zebu cattle): 109572117
Entry
109572117         CDS       T04792                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2 isoform X1
  KO
K03259  translation initiation factor 4E
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu03013  RNA transport
biu04066  HIF-1 signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04211  Longevity regulating pathway
biu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109572117 (EIF4E2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    109572117 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    109572117 (EIF4E2)
   04150 mTOR signaling pathway
    109572117 (EIF4E2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109572117 (EIF4E2)
  09149 Aging
   04211 Longevity regulating pathway
    109572117 (EIF4E2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109572117 (EIF4E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109572117 (EIF4E2)
   03012 Translation factors [BR:biu03012]
    109572117 (EIF4E2)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     109572117 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     109572117 (EIF4E2)
Translation factors [BR:biu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    109572117 (EIF4E2)
SSDB
Motif
Pfam: IF4E Stm1_N
Other DBs
NCBI-GeneID: 109572117
NCBI-ProteinID: XP_019834222
UniProt: A0A6P5DB36
LinkDB
Position
2
AA seq 245 aa
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQSSSKRKAVVPXPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGSQRLLFQNLWKP
RLNVP
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagagtcagagc
agcagyaagaggaaggctgtcgtccctgkgccggccgagcacccactgcagtataactac
actttttggtactccaggagaacccccggccgtcccaccagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttacagccac
atggtgcgtcccggggacttgacaggccacagcgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggcggaaagtggataattcgactgcgg
aagggcttggcatcccgctgctgggagaatctcatcttggctatgctgggggaacagttc
atggttggggaggagatctgcggggctgtggtctctgtccgctttcaggaggacattatt
tccatatggaataagactgccagcgatcaagccaccacggcccgcatacgggatacgctt
cggcgagtgcttaacctacctcccaacaccattatggaatacaaaacccacaccgacagc
atcaaaatgccaggcaggctgggctcccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

DBGET integrated database retrieval system