KEGG   Bos indicus (zebu cattle): 109560381
Entry
109560381         CDS       T04792                                 

Gene name
RBPJ
Definition
(RefSeq) recombining binding protein suppressor of hairless isoform X1
  KO
K06053  recombining binding protein suppressor of hairless
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04330  Notch signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu05017  Spinocerebellar ataxia
biu05165  Human papillomavirus infection
biu05169  Epstein-Barr virus infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109560381 (RBPJ)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109560381 (RBPJ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109560381 (RBPJ)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    109560381 (RBPJ)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109560381 (RBPJ)
   05165 Human papillomavirus infection
    109560381 (RBPJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109560381 (RBPJ)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Other transcription factors
   Others
    109560381 (RBPJ)
SSDB
Motif
Pfam: BTD LAG1-DNAbind TIG RHD_dimer
Other DBs
NCBI-GeneID: 109560381
NCBI-ProteinID: XP_019818107
UniProt: A0A6P5BYK1
LinkDB
Position
6
AA seq 504 aa
MEGCLPTHHTLPEKHLYAHWLLQRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVA
QKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLN
LEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKN
ADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFT
VRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERM
YLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPV
VESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWR
WVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTN
SEGSYTNVSTNSTSVTSSTATVVS
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggagggctgccttcccactcatcataccctcccagagaaacatctgtatgcccactgg
ctgcttcaaagaaaatttggtgagcggcctccacctaaacgactcactagagaagctatg
cgaaattatttaaaagagcgaggggatcaaacagtgcttattcttcatgcaaaagttgca
cagaagtcatatggaaatgaaaaaaggtttttttgccctcctccttgtgtatatcttatg
ggcagtggatggaagaaaaaaaaagaacaaatggaacgcgatggttgttcagaacaggaa
tctcaaccatgtgcttttattggaataggaaatagtgaccaagaaatgcagcaactgaac
ttggaaggaaagaactattgcacagccaaaacattrtatatatctgattcagacaagaga
aagcacttcatgctgtctgtaaagatgttctatggcaacagtgatgacattggtgtgttc
ctaagcaagcggataaaagtcatctccaaaccttccaaaaagaagcagtcactgaaaaat
gctgacctctgcattgcctcaggaacaaaggtggctctgtttaatagactccgatcccag
acagttagcaccagatacttgcatgtagaaggtggtaatttccatgccagttctcagcag
tggggagcattttacattcatctcttggatgatgatgaatcagaaggagaagaattcaca
gtccgcgatggatacatccattatggacaaacagtcaaacttgtgtgttcagttactggc
atggcactcccaagattgataattaggaaggttgataagcagaccgcgttactggatgcc
gatgatcctgtgtcacagctccacaaatgtgcgttttaccttaaggatacagaaagaatg
tacttgtgcctttctcaagaaagaataatccagtttcaggccactccatgcccaaaagaa
ccaaataaagagatgataaatgatggagcttcctggacaatcattagtacggataaggca
gagtatacattttatgaggggatgggccctgtcctcgccccagtcacacctgtgcctgtc
gtagaaagtcttcagttgaatggcggtggggacgtagcaatgcttgaacttacaggacag
aatttcactccaaatttacgagtgtggtttggggatgtagaagctgaaactatgtacaga
tgtggagagagtatgctctgtgttgtcccagacatttctgcattccgagaaggctggaga
tgggtccggcagccagtccaggttccagtaactttggtccgtaatgatggaatcatttat
tccaccagccttacctttacctataccccagaaccagggccacggccacactgcagtgca
gcgggagcaatccttcgagccaactcaagccaagtgccccctaatgaatcaaacacaaac
agcgagggaagttacacaaacgtcagcacaaattcaaccagtgtcacatcrtctacagca
acagttgtgtcctaa

KEGG   Bos indicus (zebu cattle): 109567480
Entry
109567480         CDS       T04792                                 

Gene name
RBPJL
Definition
(RefSeq) recombining binding protein suppressor of hairless-like protein
  KO
K06053  recombining binding protein suppressor of hairless
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04330  Notch signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu05017  Spinocerebellar ataxia
biu05165  Human papillomavirus infection
biu05169  Epstein-Barr virus infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109567480 (RBPJL)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109567480 (RBPJL)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109567480 (RBPJL)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    109567480 (RBPJL)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109567480 (RBPJL)
   05165 Human papillomavirus infection
    109567480 (RBPJL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109567480 (RBPJL)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Other transcription factors
   Others
    109567480 (RBPJL)
SSDB
Motif
Pfam: BTD LAG1-DNAbind
Other DBs
NCBI-GeneID: 109567480
NCBI-ProteinID: XP_019828016
UniProt: A0A6P5CPL6
LinkDB
Position
13
AA seq 517 aa
MDPVGADPSAPPGPLTHLSLPDSSEARPQSGADGRSLPGSWTRSSSEPSAVLREGVRRCL
QQQCEQTVWILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPVPGQAHQAGQTGPLVC
GYMGLDGASGSAPETQKLNFEEQPDSREFSCAKTLYISDADKRKHFRLVLRLMLRGGREL
GTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGDFVAS
ARQWAAFTLHLADEQCSQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCALL
DVDEPISQLHKCAFQFPGGPPGGGGTYLCLATEKVVQFQASPCPNEANRALLNDNSCWTI
IGTESVEFSFSTSLACTREPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDVE
AETMYRSPRSLVCVVPDVAVFGSDWRWLRTPITVPVSLVRTDGLFYPSAFSFTYTPEYSA
RPGAPGALAAPAADADXLLESIHHEFTRTNFHLFIQT
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggaccccgtgggggcagacccctcggcacccccgggccctttgactcacctgagcctg
ccggacagctcagaggcgcggccgcagagcggagccgacgggcggagcctccctggcagt
tggaccaggtcgtcttcggagcccagtgcggtcctgagggaaggcgtgcgccgctgcctg
cagcagcagtgcgagcagacggtttggatcctgcacgccaaggtggcccagaaatcatac
ggaaatgagaagaggttcttctgcccgccgccctgtgtctacctcgcaggtccgggctgg
agggtgaagccagtaccgggccaagcccaccaagcagggcagactgggcccctggtctgc
ggttacatgggactagacggcgcgtccggcagcgcccccgagacgcagaagttgaatttc
gaagagcagcccgactccagggaattcagttgcgccaagactctgtacatctcggacgca
gacaagaggaagcacttccgactggtgttgcggctcatgctccgaggcggccgggagctg
ggcaccttccacagccgcctcatcaaggtcatctccaagccctcgcagaagaaacagtcg
ctgaaaaacaccgacctgtgcatatcctcgggctcgaaggtctccctcttcaaccgcctg
cgctcccagacggtctccacgcgctacctctccgtggaggacggggactttgtggccagt
gcacgccagtgggctgccttcactctccacctggctgatgaacagtgttcccagggggac
ttcccgcctcgagagggctacgtccgctacggctccctggtgcagctcgtctgcacggtc
acgggcatcaccctacctccaatgatcatccgcaaagtagccaaacagtgtgccctcctc
gacgtggatgagcccatctcgcaactccacaagtgtgcattccagtttcccggtggtcct
ccaggaggaggcggcacctacttatgtctcgctacagagaaggtggtgcagtttcaggcc
tccccctgccccaacgaggccaacagagcgctgctcaacgacaactcttgctggaccatc
atcggcaccgagtcggtggaattctccttcagcaccagcctggcgtgcacccgggagccg
gtcactcccgtgccgctcatcagcaccctcgagctgagtggcgggggcgacgtggccacc
ctggagctccacggtgagaacttccacgcggggctcaaggtgtggttcggggacgtggaa
gcggaaaccatgtacaggagcccgcggtccctggtgtgtgtggtacccgacgtagccgtc
ttcggcagcgactggcgctggctgcgcacacccatcacagtgcccgtgagcctcgtgcgc
accgacggccttttctaccccagcgccttctccttcacctacacgcccgagtacagcgcg
cggccgggggccccgggcgccctggcggcgcccgccgctgacgccgacgygctcctggag
agcatccatcacgagttcacgcgcaccaacttccacctcttcatccagacgtag

DBGET integrated database retrieval system