KEGG   Bos indicus (zebu cattle): 109560475
Entry
109560475         CDS       T04792                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04072  Phospholipase D signaling pathway
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05163  Human cytomegalovirus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109560475 (PDGFRA)
   04014 Ras signaling pathway
    109560475 (PDGFRA)
   04015 Rap1 signaling pathway
    109560475 (PDGFRA)
   04630 JAK-STAT signaling pathway
    109560475 (PDGFRA)
   04020 Calcium signaling pathway
    109560475 (PDGFRA)
   04072 Phospholipase D signaling pathway
    109560475 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    109560475 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109560475 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109560475 (PDGFRA)
   04540 Gap junction
    109560475 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109560475 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560475 (PDGFRA)
   05206 MicroRNAs in cancer
    109560475 (PDGFRA)
   05230 Central carbon metabolism in cancer
    109560475 (PDGFRA)
   05231 Choline metabolism in cancer
    109560475 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    109560475 (PDGFRA)
   05218 Melanoma
    109560475 (PDGFRA)
   05215 Prostate cancer
    109560475 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109560475 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109560475 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109560475 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109560475 (PDGFRA)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109560475 (PDGFRA)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109560475 (PDGFRA)
CD molecules [BR:biu04090]
 Proteins
  109560475 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2 Kinase-like LAT
Other DBs
NCBI-GeneID: 109560475
NCBI-ProteinID: XP_019818324
LinkDB
Position
6
AA seq 1089 aa
MGTSHWALLVLGCLFTGLSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEEYPDVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQMDENEIEGRHIYIY
VPDPDVAFVPLGMTDSLVIVEDEDSVIIPCRTTDPETPVTLLSSEGIVPASYDSRQGFKG
TFSVGLYICEATVRGKKFQTIPFNVYAYTATSKLDLEMESPKTVYKAGESIVVTCTVFNN
EVVDFQWTYPGQMKGKGITRLEETKFPSIKLVYTLRVPEATVKDSGDYECAAHQATKEVK
KMRNVTISVHEKGFIEIKPNFNLLEAVNLHEVKHFVVDVQAYPPPKITWLKDNLTLIENL
TEITTDIEKIQEISYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWTVLANNVSNIITGVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcttcacagggctgagccta
atcctctgccagctttcattaccctccatcctgcccaatgaaaatgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagtaccccgacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacagtgctggaagtggtcagcgcctcggcggcccacactgggctgtacacttgc
tattacaaccacacgcagatggacgagaacgagatcgagggcaggcacatttacatctac
gtgccagacccagatgtagccttcgtacctctaggaatgacagattccttggtcatcgtg
gaggacgaagattcggtcatcatcccatgccgcacgactgatcctgagactccagtgacc
ttactcagcagtgaggggatagtgcctgcctcctatgacagcagacaaggctttaaagga
accttcagtgtcgggctctatatctgtgaggccacggtcagagggaagaagttccagacc
attccattcaatgtttatgcttacacagcaacatcaaaacttgatctggaaatggaatct
cctaagactgtgtataaggcaggcgaatcaattgtggtcacctgcaccgtctttaacaac
gaggtggttgactttcagtggacttaccctggacaaatgaaaggcaaaggcatcacgagg
ctggaggaaaccaagttcccgtccatcaagttggtgtacactctgagggttcccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccaccaggccaccaaggaggtcaaa
aagatgaggaacgtcaccatttctgttcacgagaaaggatttattgaaatcaaacccaac
tttaacctgttggaagctgtcaacctgcatgaagtcaagcattttgtggtggatgtgcag
gcctatccccctcccaagataacctggctaaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataagttatcgaagcaaattaaag
ctgatccgagcaaaggaagaagacagcggccattatactattgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactcttgactcaagttccatcctccatactggacttg
gttgacgaccaccatggctctaatgggggccagactgtgagatgcacagccgaagggacc
cctcttcctgatatcgagtggatggtttgcaaggatattaagaaatgtaacaatgaaact
tcatggacagttttggccaacaacgtttcaaacatcatcacaggggtccacccccgagac
aggagcacagtggaaggccaggtgacatttgccaaagtggaggagaccattgcagtccgg
tgtctggccaagaacctcctcggggtggaaagccgagagctgaagctggtggctcccact
ctgcgctctgagctcactgtggcggctgctgtcctggtgttgttggtgattgtgatcatc
tcactcattgtcctggtcgtcatttggaaacagaaaccaaggtatgaaatccgttggagg
gtcattgaatcaatcagccctgatggacatgaatacatttatgtggacccgatgcagctg
ccttacgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctgggg
tctggtgcatttgggaaagtggttgaaggaactgcttatggattaagtcggtctcaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccacatttaaacatcgtgaacttg
ctgggcgcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccaccatccagagaag
ccaaagaaagagctggacatttttggattgaacccggctgacgaaagcacaagaagttac
gttatcttatcttttgaaaataatggtgactacatggacatgaagcaagctgacacgaca
cagtatgtccccatgctggagagaaaagaggtttctaaatactcggacatccagagagcg
ctgtatgatcgcccagcctcgtataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggcctgactttgttggatttgttgagctttacctat
caagtcgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacctggcg
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtccaaaggcagtacctttctccccgtgaag
tggatggctcctgagagcatctttgacaacctgtacaccacgctgagtgacgtctggtcc
tatggcatcctgctctgggagatcttttcccttggtggcacaccctaccctggcatgatg
gtggactctacattctacaataagatcaagagtggataccggatggccaagcctgaccat
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgaaattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggactttctgaagagtgaccatcccgctgtggcacgcatg
cgcgtggactccgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagtgcagatagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaagacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctacgttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggatctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system