KEGG   Bos indicus (zebu cattle): 109560477
Entry
109560477         CDS       T04792                                 

Gene name
KIT
Definition
(RefSeq) mast/stem cell growth factor receptor Kit isoform X1
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04072  Phospholipase D signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04640  Hematopoietic cell lineage
biu04916  Melanogenesis
biu05200  Pathways in cancer
biu05221  Acute myeloid leukemia
biu05224  Breast cancer
biu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109560477 (KIT)
   04014 Ras signaling pathway
    109560477 (KIT)
   04015 Rap1 signaling pathway
    109560477 (KIT)
   04072 Phospholipase D signaling pathway
    109560477 (KIT)
   04151 PI3K-Akt signaling pathway
    109560477 (KIT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109560477 (KIT)
  09152 Endocrine system
   04916 Melanogenesis
    109560477 (KIT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560477 (KIT)
   05230 Central carbon metabolism in cancer
    109560477 (KIT)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109560477 (KIT)
   05224 Breast cancer
    109560477 (KIT)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109560477 (KIT)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109560477 (KIT)
CD molecules [BR:biu04090]
 Proteins
  109560477 (KIT)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 Ig_6 C1-set V-set Pkinase_fungal APH
Other DBs
NCBI-GeneID: 109560477
NCBI-ProteinID: XP_019818328
UniProt: A0A6P5BYE0
LinkDB
Position
6
AA seq 982 aa
MEINIGKNALFRPRKRSCSTRFSFFLAGSSQPSVSPGELSLPSIHPAKSELIVSVGDEIR
LLCTXPGFVKWTFEILGQLSEKTNPEWITEKAEATNTGNYTCTNKGGLSSSIYVFVRDPE
KLFLIDLPLYGKEENDTLVRCPLTDPEVTNYSLTGCEGKPLPKDLTFVADPKAGITIRNV
KREYHRLCLHCSANQRGKSMLSKKFTLKVRAAIKAVPVVSVSKTSYLLREGEEFAVTCLI
KDVSSSVDSMWIKENSQQTKAQTKKNSWHQGDFSYLRQERLTISSARVNDSGVFMCYANN
TFGSANVTTTLEVVDKGFINIFPMMNTTVFVNDGENVDLVVEYEAYPKPVHRQWIYMNRT
STDKWDDYPKSENESNIRYVNELHLTRLKGTEGGTYTFHVSNSDVNSSVTFNVYVNTKPE
ILTHDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSVPVGPVDVQIQNSSVSPFGKLVV
YSTIDDSTFKHNGTVECRAYNDVGKSSASFNFAFKGNSKEQIHAHTLFTPLLIGFVIAAG
LMCIFVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKT
LGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIV
NLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEVALYKNLLHSKESSC
NDSTNEYMDMKPGVSYVVPTKADKRRSARIGSYIERDVTPAIMEDDELALDLEDLLSFSY
QVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVK
WMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEH
APAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPHRENPAVDHS
VRINSVGSSASSTQPLLVHEDV
NT seq 2949 nt   +upstreamnt  +downstreamnt
atggaaatcaatattggaaaaaatgctttatttcgcccaagaaaaagatcatgttcaaca
cgattttcgtttttcttggcaggctcttctcagccatctgtgagtccaggggaactgtct
ctaccatctatccacccagcaaaatcagagttaattgtcagcgttggcgacgagattagg
ctgttatgcactgrtccaggatttgtcaagtggacttttgagatcctgggtcaactgagt
gagaaaacaaacccggaatggatcaccgagaaagcagaggccacaaatacaggcaattac
acgtgcaccaataaaggcggcttgagcagttccatttatgtgtttgttagagaccccgag
aagcttttyctgattgaccttcccttgtacgggaaagaagaaaacgacacgctggttcgc
tgtcccctgacagaccccgaggtgaccaattactctcttacggggtgtgaggggaaacct
ctccccaaggatttgacgtttgtggccgaccccaaggcaggtatcacaatcagaaatgtg
aagcgcgagtaccatcggctctgtctgcactgctcagcgaatcagaggggcaagtccatg
ctgtcgaagaaattcactctgaaagtgcgggcagccatcaaagctgtgccagttgtgtct
gtgtccaaaaccagctatcttctcagggaaggagaggaatttgcagtgacatgcttgatt
aaagacgtgtctagttccgtggactctatgtggataaaggaaaacagccagcagactaaa
gcacagacgaagaagaatagctggcatcagggtgacttcagttatctccgtcaggaaagg
ttgactatcagctcagcaagagtgaatgattccggtgtgttcatgtgttacgccaataac
acttttggatcagcaaatgtcacaacaaccttagaagtagtagataaaggattcattaat
atcttccctatgatgaacacaacagtatttgtaaatgatggagagaatgtggatctggtt
gttgaatatgaggcatatcccaaacctgtacaccgacaatggatatatatgaacagaacc
tccactgataagtgggacgattatcctaagtctgaaaatgaaagtaatatcagatacgta
aatgaacttcatctaaccagattaaaagggactgaaggaggcacttacacatttcacgtg
tccaattctgatgtcaattcttccgtgacatttaatgtttacgtgaacacaaaaccagaa
atcctgacgcatgacaggctggtgaatggcatgctacagtgcgtggccgcagggttcccg
gagccaaccatcgattggtacttttgtccaggaactgagcagaggtgttctgttcccgtt
gggccagtggatgtacagatccaaaactcatctgtctcaccatttggaaaactagtrgtt
tatagcaccattgatgacagcacattcaaacacaatgggacggtggagtgcagggcttat
aacgatgtgggcaagagttctgcctcttttaactttgcatttaaaggtaacagcaaagaa
caaatccatgctcacaccctgttcacgccgttgctgattggttttgtgatcgcagctggt
ttaatgtgtatcttcgtgatgattcttacatacaaatatttgcagaaacccatgtatgaa
gtacagtggaaagttgtcgaggagataaatggaaacaattatgtttacatagacccaaca
caacttccttatgatcacaaatgggagtttcccaggaacaggctgagttttgggaaaacc
ctgggtgctggcgccttygggaaagttgttgaggccaccgcttatggcttaattaaatca
gatgcagccatgactgttgctgtcaagatgctcaaaccaagcgcccatttaacagaacga
gaagccctaatgtctgaactcaaagtcttgagttacctcggtaatcatatgaatattgtg
aatcttctgggagcgtgcaccattggagggcccaccctggtcattacagaatattgttgc
tatggtgatcttctgaattttttgagaagaaaacgtgattcatttatttgctcaaagcag
gaagatcacgccgaagtggcgctttataagaaccttcttcattcaaaggagtcttcctgc
aatgatagtactaatgagtacatggacatgaaacctggagtttcttatgttgtaccaacc
aaggcagacaagaggagatctgcaagaataggttcatacatagaaagagacgtgactcct
gctatcatggaagatgatgagctggccctggacctggaggacttgctgagcttttcttac
caggtggcaaaaggcatggcrttccttgcctcaaagaattgtattcatagagacttggca
gccagaaatatcctccttactcatggtcgaatcacaaagatttgtgattttggtctagcc
agagacatcaagaatgattctaattatgtggtcaaaggaaacgctcgactccctgtgaag
tggatggcaccagagagtattttcaactgtgtatacacatttgaaagtgatgtctggtcc
tatgggatttttctgtgggagctgttctctttaggaagcagcccctaccctggaatgcca
gtcgattctaagttctacaagatgatcaaggaaggtttccgaatgctcagccccgagcat
gcacctgcggaaatgtatgacatcatgaagacctgctgggatgctgatcccttgaaaagg
ccaacatttaagcagattgtgcagctgattgagaagcagatctcagagagcaccaatcat
atttattccaacttagcaaactgcagcccccaccgggagaaccccgccgtggaccattct
gtgcgcatcaactctgtgggcagcagcgcctcctccacgcagcctctgcttgtccacgaa
gatgtctga

DBGET integrated database retrieval system