KEGG   Bos indicus (zebu cattle): 109560553Help
Entry
109560553         CDS       T04792                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu05164  Influenza A
biu05202  Transcriptional misregulation in cancer
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    109560553 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    109560553 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    109560553 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:biu01002]
    109560553 (TMPRSS2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109560553 (TMPRSS2)
Peptidases [BR:biu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109560553 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 109560553
NCBI-ProteinID: XP_019818444
LinkDB All DBs
Position
1
AA seq 490 aa AA seqDB search
MALNSGSSPGVGPYYENHGYQPESLYPQQPPTAPPAFEVYPAQYYPPVVPQYTPRVQTHA
STPVIYRQPKPPSRTACTSKTKKALCITFTLVVLLAGAILAAVLLWKYMEDECSGMECSS
SGTCVSPSLWCDGILHCPSGEDENRCVRLYGPNFILQVYSAQRKSWHPVCQDDWSESYGR
AACQDMGYRNSFYSSQGIADDSGATSFMKLNISANDIDLYKKLYHSDVCSSKTVVSLRCI
ECGVSVKTSRQSRIVGGSNAYSGEWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPL
NNPKIWVAFAGILKQSYMFYGSGYRVAKVISHPNYDSKTKNNDIALMKLQTPLTFNDKVK
PVCLPNPGMMLEPTQSCWISGWGATYEKGKTSDDLNAAKVHLIEPRKCNSKYMYDNLITP
TMICAGYLQGTVDSCQGDSGGPLVTLKSSVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTD
WIYQQMRANS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaactcaggatcatcaccaggtgtcgggccttactatgagaaccatggatac
cagccggaaagcttgtaccctcagcagccgcccacggctccccctgctttcgaggtgtac
cccgctcagtactacccgcccgtggtgccccagtacaccccaagggttcagacgcacgcc
tcgacacctgtcatctacaggcagcccaaacctccatccaggacagcgtgcacctcaaag
actaagaaagccctgtgcatcaccttcaccctggtggtcctgctggcaggagcaatcctt
gccgccgtcctcctctggaagtacatggaggacgagtgttcagggatggagtgcagctcc
tcygggacctgtgttagcccctctctctggtgcgatggcatcctgcactgccccagtggc
gaggacgagaaccgctgcgttcgcctctatggaccgaacttcatccttcaggtgtactca
gcacagaggaagtcctggcaccccgtgtgccaggaygactggagtgagagctacgggagg
gcggcctgccaggacatgggctaccggaacagtttttattctagccaaggaatagcagat
gacagcggagccacaagctttatgaagctgaacataagtgccaatgatatcgatctctat
aaaaaactctaccacagcgatgtttgttcttcaaaaacagtggtttctttacgctgtata
gaatgcggggtctccgtgaagacgagccgccagagccggatcgtggggggatcgaatgct
tactcgggcgaatggccctggcaggttagcctgcacgtgcagggcatccacgtctgtggg
ggctccatcatcaccccggagtggatcgtgacagccgcrcactgcgtagaggaacctctt
aacaatcccaagatctgggtggcctttgcaggaatcttgaaacaatcttacatgttctat
ggaagtggataccgagtagcaaaagtgatttcccacccaaattatgattccaagaccaag
aacaatgacatcgcgctaatgaagctgcagacgcctctgactttcaacgacaaagtgaag
ccagtgtgtctacccaatccaggcatgatgctggagccaactcagtcctgctggatttcc
gggtggggggccacctacgagaaagggaagacctcagatgacctgaacgcggccaaggtg
cacctcattgagccccggaagtgcaacagcaagtacatgtacgacaacctcatcacgccc
accatgatctgtgcaggctacctgcagggcaccgtcgactcctgccagggtgacagtgga
ggtcctctggtcacactraagagcagtgtctggtggctgattggagacacgagctggggg
tcaggctgtgccaaggcgtaccgaccgggagtgtacgggaacgtgacagtgttcacagac
tggatctatcaacaaatgagggcaaacagctaa

DBGET integrated database retrieval system