KEGG   Bos indicus (zebu cattle): 109560570
Entry
109560570         CDS       T04792                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04062  Chemokine signaling pathway
biu04064  NF-kappa B signaling pathway
biu04072  Phospholipase D signaling pathway
biu04218  Cellular senescence
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05135  Yersinia infection
biu05142  Chagas disease
biu05144  Malaria
biu05146  Amoebiasis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05219  Bladder cancer
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109560570 (CXCL8)
   04072 Phospholipase D signaling pathway
    109560570 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109560570 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109560570 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109560570 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109560570 (CXCL8)
   04621 NOD-like receptor signaling pathway
    109560570 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    109560570 (CXCL8)
   04657 IL-17 signaling pathway
    109560570 (CXCL8)
   04062 Chemokine signaling pathway
    109560570 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560570 (CXCL8)
   05202 Transcriptional misregulation in cancer
    109560570 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    109560570 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109560570 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109560570 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109560570 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109560570 (CXCL8)
   05135 Yersinia infection
    109560570 (CXCL8)
   05133 Pertussis
    109560570 (CXCL8)
   05134 Legionellosis
    109560570 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109560570 (CXCL8)
   05171 Coronavirus disease - COVID-19
    109560570 (CXCL8)
   05164 Influenza A
    109560570 (CXCL8)
   05163 Human cytomegalovirus infection
    109560570 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109560570 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109560570 (CXCL8)
   05144 Malaria
    109560570 (CXCL8)
   05142 Chagas disease
    109560570 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109560570 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109560570 (CXCL8)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Chemokines
   109560570 (CXCL8)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Chemokines
   109560570 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 109560570
NCBI-ProteinID: XP_019818472
UniProt: B1PSL8
LinkDB
Position
6
AA seq 101 aa
MTSKLAVALLAAFLLSAALCEAAVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPH
CENSEIIVKLTNGNEVCLNPKEKWVQKVVQVFVKRAEKQDP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggcagctttcctgctctctgcagctctgtgt
gaagctgcagttctgtcaagaatgagtacagaacttcgatgccaatgcataaaaacacat
tccacacctttccaccccaaatttatcaaagaattgagagttattgagagtgggccacac
tgtgaaaattcagaaatcattgttaagcttaccaatggaaacgaggtctgcttaaacccc
aaggaaaagtgggtgcagaaggttgtgcaggtatttgtgaagagagctgagaagcaagat
ccatga

KEGG   Bos indicus (zebu cattle): 109560575
Entry
109560575         CDS       T04792                                 

Definition
(RefSeq) C-X-C motif chemokine 15-like isoform X1
  KO
K10030  interleukin 8
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04062  Chemokine signaling pathway
biu04064  NF-kappa B signaling pathway
biu04072  Phospholipase D signaling pathway
biu04218  Cellular senescence
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05135  Yersinia infection
biu05142  Chagas disease
biu05144  Malaria
biu05146  Amoebiasis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05219  Bladder cancer
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109560575
   04072 Phospholipase D signaling pathway
    109560575
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109560575
   04061 Viral protein interaction with cytokine and cytokine receptor
    109560575
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109560575
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109560575
   04621 NOD-like receptor signaling pathway
    109560575
   04622 RIG-I-like receptor signaling pathway
    109560575
   04657 IL-17 signaling pathway
    109560575
   04062 Chemokine signaling pathway
    109560575
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560575
   05202 Transcriptional misregulation in cancer
    109560575
  09162 Cancer: specific types
   05219 Bladder cancer
    109560575
  09163 Immune disease
   05323 Rheumatoid arthritis
    109560575
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109560575
   04933 AGE-RAGE signaling pathway in diabetic complications
    109560575
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109560575
   05135 Yersinia infection
    109560575
   05133 Pertussis
    109560575
   05134 Legionellosis
    109560575
  09172 Infectious disease: viral
   05161 Hepatitis B
    109560575
   05171 Coronavirus disease - COVID-19
    109560575
   05164 Influenza A
    109560575
   05163 Human cytomegalovirus infection
    109560575
   05167 Kaposi sarcoma-associated herpesvirus infection
    109560575
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109560575
   05144 Malaria
    109560575
   05142 Chagas disease
    109560575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109560575
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109560575
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Chemokines
   109560575
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Chemokines
   109560575
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 109560575
NCBI-ProteinID: XP_019818476
UniProt: A0A6P5BYS8
LinkDB
Position
6
AA seq 102 aa
MATESSQMFLLLAVLVLGIFADPSESQELRCQCIQTQSDFISPKFIAKVQIIPEGAHCNR
KEIMCSLHILDIKPSSNLWIEKLIFQFVVHVFNLSVVSFQLV
NT seq 309 nt   +upstreamnt  +downstreamnt
atggctactgagagctcacaaatgttcctcctgttggccgtccttgtcctgggcatcttt
gctgatccctctgagagccaagagctgcgatgccagtgtattcagacacaatctgacttt
atttctcccaaattcattgcaaaagtccagataatccctgaaggtgctcactgcaacaga
aaagaaatcatgtgttctttacacattctggatattaaaccctcatcaaatttatggata
gaaaagctcattttccaatttgtggttcatgtttttaatctttctgtggtgtcctttcaa
ttagtataa

DBGET integrated database retrieval system