KEGG   Bos indicus (zebu cattle): 109560687
Entry
109560687         CDS       T04792                                 

Gene name
CD38
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 isoform X1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00760  Nicotinate and nicotinamide metabolism
biu01100  Metabolic pathways
biu04020  Calcium signaling pathway
biu04640  Hematopoietic cell lineage
biu04921  Oxytocin signaling pathway
biu04970  Salivary secretion
biu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    109560687 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109560687 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109560687 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109560687 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    109560687 (CD38)
   04972 Pancreatic secretion
    109560687 (CD38)
Enzymes [BR:biu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     109560687 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     109560687 (CD38)
CD molecules [BR:biu04090]
 Proteins
  109560687 (CD38)
Glycosaminoglycan binding proteins [BR:biu00536]
 Hyaluronan
  Cell surface receptors
   109560687 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 109560687
NCBI-ProteinID: XP_019818678
UniProt: A0A6P5BZF2
LinkDB
Position
6
AA seq 299 aa
MADCCTPRKKLCWCVLLFFLVAGITGGAIGIYKWHYSGLNRWHGAGSTADFQKIIQERCD
TYTQTIRPGSRSRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFWSK
TKELAHEYAKRRRLMTLEDTLLGYLADGLRWCGEPGSSDLNIWSCPDWRKDCRTNYLSVF
WEVLSERFAESACNTVRVVLNGSLENAFDSMSIFGRVEAPNLRPQVELEAWLVHDTGKPP
SDSCSGSSIRKLKSILDGRNVKFRCMDNLRNKLTQACTLPAGRDALGAVLTDFLACSFS
NT seq 900 nt   +upstreamnt  +downstreamnt
atggccgactgctgcacgccgagaaagaagctttgctggtgcgttcttctgttcttcctg
gtggcggggatcaccgggggggcgatcggcatctacaagtggcactactccgggctcaac
aggtggcacggggcaggcagcaccgccgattttcagaaaatcatccaggagcgatgcgac
acctacacccagacgatccggccgggttccagaagcagaaactgccaagcgatcaggcag
gcattcatgagtgccttcatttccaaggatccctgcaaagcgacaaaggaagactacaac
tccctgatcaacctggcacctcccactgtgccttgtggccagcaagtcttctggagcaaa
acgaaggagctggctcatgaatacgcgaaaaggcggcgcctgatgactctggaggacacg
ctgctgggttaccttgcggatggcctcaggtggtgtggagagccaggctcttctgatttg
aacatttggtcttgtccagactggaggaaagactgcagaaccaactatctttctgtattc
tgggaagtgctgtctgaaaggtttgcagaaagtgcctgtaatacagtccgggtggtgctc
aatggatcgttggagaacgcctttgatagcatgagcatatttggacgagtggaagcccct
aacttgaggccacaggttgaactagaggcttggctggtacatgacactggaaaacctccc
agtgactcatgctctggctcctctataaggaaactgaagtccatcttagatggaagaaat
gtcaaatttagatgcatggataatctcagaaacaaactcacccaagcctgcacactccct
gctggaagagatgccttaggagccgtgctgactgacttcctggcatgcagtttctcctga

DBGET integrated database retrieval system