KEGG   Bos indicus (zebu cattle): 109560970Help
Entry
109560970         CDS       T04792                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:biu01002]
    109560970 (TMPRSS9)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109560970 (TMPRSS9)
Peptidases [BR:biu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109560970 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 109560970
NCBI-ProteinID: XP_019818970
LinkDB All DBs
Position
7
AA seq 977 aa AA seqDB search
MEPTASDLQLVPGATKDVLAADAMCCRAALSTVVATSIVLVILGVLVASLSXQGVDVEHM
AELRGIRFAPSLQQETSEYYRTLTPALEMLLHFLLLALWTPSPGLEEQLLQRGLHXRLQG
LGIPLAPYGTIVSAQLTGSQKGPLTERDLKSGRCPGNAFSCGNSQCVTKVNPECDDTSDC
SDGSDEAHCDCGLQPGWKTAGRIVGGVEASPGEFPWQVSLRENNEHFCGAAIISARWLVS
AAHCFNEVTPQLPPPPPQETLGVQQAGVARIITHPSYNSDTADFDVAVLELGRPLPFSRH
VQPVCLPAASHIFPPRKKCLISGWGYLKENFLVKPEMLQKATVELLDQALCTSLYGHSLT
DRMVCAGYLDGKVDSLPEVGGGLLSLVHHQDLCWAEVPGPSCLVPAECGARPALEKPTRI
VGGLGASLGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAQLGTASLS
GVGGSPVKVGLRRVVLHPQYNPSILDFDVAVLELARPLVFNKYVQPVCLPLAIQKFPVGR
KCVISGWGNTQEGNATKPDLLQQASVGIIDHKACSALYNFSLTDRMICAGFLEGKVDSCQ
GDSGGPLACEETPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILATMSSHLLPTAP
LPTTRMPTSSHATRTTAGLTVPGVMASTPTPWATSRVTSQPADRTTTTVTSTPRGQTPLP
PAPKTTVGAQLPDCGLAPAAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERW
LLSAAHCFDVYGDPKQWAAFLGTPFLSGADGQLERVARIHKHPFYNLYTLDYDVALLELV
GPVRRSRLVRPICLPEPAPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRR
FYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPQFPGV
YTRVAAVRGWIGQNIQE
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggagcccactgccagtgacttacagctggtgcctggagccaccaaggacgtcctggct
gcagatgccatgtgctgccgggcggccctgtccactgttgtggccaccagcatcgtcctc
gtcatcctgggagtccttgtggcctccctctctayacagggcgtcgacgtagagcacatg
gctgagctgcgtgggatccggtttgcccccagcttgcagcaggagacctcagagtactac
cgcacgctgacgcccgctctggaaatgctgctgcactttctgytgctggccctgtggacg
ccaagcccaggcctggaggagcagctattgcagcggggacttcatgygaggctgcagggc
ctcggcatccccctagccccctatggcaccattgtgtctgcccagctcacaggaagccag
aaggggccgctgacagaaagagacttaaaatcaggccgctgtccagggaatgccttttcc
tgcgggaacagccagtgtgtgaccaaggtgaacccagagtgtgatgacacctcggactgc
tccgacggctccgacgaggcccactgygactgtggcttgcagcctggctggaagacagct
ggcaggattgtgggtggtgtggaagcgtccccaggggagttcccttggcaagtcagcctc
cgtgaaaacaacgagcacttctgtggggccgccatcatcagcgccaggtggctggtgtcc
gctgcccactgcttcaaygaggtgaccccacagctgccacccccacctccccaggagacc
ctcggagtccagcaggcaggcgtggcccggatcatcacacacccatcctacaactcggac
acagctgacttcgacgtggcggtgctggagctgggcagacccctgcccttcagccggcac
gtgcagcccgtgtgcctgccrgctgcctcacacatcttcccaccaaggaagaagtgcctc
atctcaggctggggctacctcaaggagaacttcctggtcaagccggaaatgctgcagaag
gccactgtggagctgctggaccaggccctgtgcaccagcctatacggccactcactcacc
gacaggatggtgtgtgctggctacctggacgggaaggtggattccctgccagaagtaggg
gggggtcttctgtctctggtccaccaccaagacctctgctgggctgaggtgcctggaccc
tcctgtcttgtccctgcagagtgtggggccaggccagcgctggagaagcccactcggatc
gtgggggggcttggggcctccttgggggaggtgccttggcaggtcagcctgaaggagggc
tcgcggcacttctgcggagccaccgtggtgggggaccgctggctgctgtctgccgcccac
tgcttcaaccacacgaaggtggagctggtgcgggctcagctgggcaccgcgtccctgtcg
ggcgttggcgggagccccgtgaaggtggggctcaggcgggtggtgctgcacccccagtac
aaccccagcatcctggacttcgacgtggccgtgctggagctggccaggcctttggtcttc
aacaagtatgtgcagcccgtctgcctgccgctggccatccagaagttccctgtgggccgc
aagtgtgtgatctccgggtggggcaacacgcaggagggcaacgccaccaagcctgacctc
ctgcagcaggcgtctgtgggcatcatagaccacaaggcatgtagcgccctctacaacttc
tcgctcacggacaggatgatctgcgccggcttcctggagggcaaggtggattcctgccag
ggtgactctgggggacccctggcctgtgaggagacacccggtgtgttttatctggctggg
atcgtgagctggggcatcggctgtgcgcaggtcaagaagccgggtgtgtacacccgcatc
acccggctcaagggctggatcctggccaccatgtcctcccacttgctccccacggccccg
ctgcccaccacraggatgcccaccagcagtcatgccaccaggacgacagcaggcctcaca
gtcccgggagtcatggccagcacacccactccctgggccaccagcagggtgaccagtcaa
cctgccgacaggaccaccacaactgtgacctccacccctaggggccagacaccactgccc
ccagctccgaagaccacggtgggcgcccagctaccagactgcggcctggcgccggctgcg
gcgctgacccggatcgtgggcggcagcgctgcgggccgcggggagtggccgtggcaggtg
agcctgtggctgcgkmggcgggagcaccgctgcggggctgtgctggtggcggagaggtgg
ctgctatcggcggcacactgcttcgacgtctacggggaccccaagcagtgggcagccttc
ctgggcacgccgttcctgagtggcgctgatgggcagctggagcgtgtggcgcgcatccac
aagcaccccttctacaacctctacacgctcgactacgacgtggcactgctcgagctggtg
gggccagtacgccgcagccgcctggtgcggcccatctgcttgcctgagcccgccccacgg
ccccccgacggcgcgcgctgcgtcatcacaggctggggctctgtgcgcgagggaggctcc
atggccaggcagctgcagaaggcggccgtgcgcctcctcagcgagcagacctgccgccgc
ttctacccggtacagatcagcagccgcatgctgtgtgccggcttcccgcagggaggcgtg
gacagctgctcgggtgacgctgggggacccctggcctgcagggagccctccggccgctgg
gtgctcactggggtcaccagctggggttatggctgtgggcggccccagttcccgggcgtg
tacacccgggtggctgctgtcagaggctggatcgggcagaacatccaggagtga

DBGET integrated database retrieval system