Bos indicus (zebu cattle): 109561216 Help Entry 109561216         CDS       T04792                                  Gene name IL5 Definition (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04630   JAK-STAT signaling pathway biu04640   Hematopoietic cell lineage biu04657   IL-17 signaling pathway biu04658   Th1 and Th2 cell differentiation biu04660   T cell receptor signaling pathway biu04664   Fc epsilon RI signaling pathway biu04672   Intestinal immune network for IgA production biu05200   Pathways in cancer biu05310   Asthma biu05320   Autoimmune thyroid disease biu05321   Inflammatory bowel disease biu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109561216 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109561216 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109561216 (IL5)    04660 T cell receptor signaling pathway     109561216 (IL5)    04658 Th1 and Th2 cell differentiation     109561216 (IL5)    04657 IL-17 signaling pathway     109561216 (IL5)    04664 Fc epsilon RI signaling pathway     109561216 (IL5)    04672 Intestinal immune network for IgA production     109561216 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109561216 (IL5)   09163 Immune disease    05310 Asthma     109561216 (IL5)    05320 Autoimmune thyroid disease     109561216 (IL5)    05321 Inflammatory bowel disease     109561216 (IL5)    05330 Allograft rejection     109561216 (IL5) Cytokines and growth factors [BR:biu04052]  Cytokines   Interleukins    109561216 (IL5) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Cytokines    109561216 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  109561216 NCBI-ProteinID:  XP_019819165 UniProt:  B5LVN5 LinkDB All DBs Position 7 AA seq 134 aa AA seqDB search MRMHLHLTLVALGAAYVCANAVESTMNRLVAETLTLLSSHRTLLIGDGNLMIPTPQHTNH QLCIEEVFQGIDTLKNQTAQGDAVKKIFQNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcatctgcatttgactttagtagctcttggagctgcttatgtttgtgccaat gctgtagaaagtaccatgaatagactggtggcagagaccttgacactgctctcctctcat cgaactctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcac caactgtgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaa ggggatgctgtgaaaaaaatattccaaaacttgtctttaataaaagaatacatagacctc caaaaaaggaagtgtggaggagaaagatggagagtgaaacaattcctagactacctgcaa gtttttcttggtgtgattaacacagagtggacaatggaaagttga

DBGET integrated database retrieval system