KEGG   Bos indicus (zebu cattle): 109561218
Entry
109561218         CDS       T04792                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04650  Natural killer cell mediated cytotoxicity
biu04657  IL-17 signaling pathway
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu05146  Amoebiasis
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05171  Coronavirus disease - COVID-19
biu05202  Transcriptional misregulation in cancer
biu05221  Acute myeloid leukemia
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561218 (CSF2)
   04668 TNF signaling pathway
    109561218 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561218 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561218 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    109561218 (CSF2)
   04660 T cell receptor signaling pathway
    109561218 (CSF2)
   04657 IL-17 signaling pathway
    109561218 (CSF2)
   04664 Fc epsilon RI signaling pathway
    109561218 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109561218 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109561218 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109561218 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561218 (CSF2)
   05171 Coronavirus disease - COVID-19
    109561218 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109561218 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109561218 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109561218 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561218 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561218 (CSF2)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     109561218 (CSF2)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109561218 (CSF2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109561218 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 109561218
NCBI-ProteinID: XP_019819167
UniProt: E1AK51
LinkDB
Position
7
AA seq 143 aa
MWLQNLLLLGTVVCSFSAPTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVS
EKFDSQEPTCLQTRLKLYKKGLQGSLTSLMSSLTMMATHYEKHCPPTPETSCGTQFISFK
NFKEDLKEFLFIIPFDCWEPAQK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttctcctgggcactgtggtctgcagcttctccgcacctact
cgcccacccaacactgccacccggccctggcagcatgtggatgccatcaaggaggccctg
agccttctgaaccacagcagtgacactgatgctgtgatgaatgacacagaagtcgtctct
gaaaagtttgactcccaggagccaacgtgcctgcagactcgcctgaagctgtacaagaag
ggcctgcagggcagcctcactagtctcatgagctccttgaccatgatggccacccactac
gagaaacactgcccacccaccccggaaacttcctgtggaacccagtttatcagcttcaaa
aatttcaaagaggacctgaaggagttcctttttatcattccctttgactgctgggaacca
gcccagaagtga

DBGET integrated database retrieval system