KEGG   Bos indicus (zebu cattle): 109561219
Entry
109561219         CDS       T04792                                 

Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04664  Fc epsilon RI signaling pathway
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05221  Acute myeloid leukemia
biu05310  Asthma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561219
   04151 PI3K-Akt signaling pathway
    109561219
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561219
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109561219
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561219
   04664 Fc epsilon RI signaling pathway
    109561219
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561219
   05202 Transcriptional misregulation in cancer
    109561219
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109561219
  09163 Immune disease
   05310 Asthma
    109561219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109561219
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109561219
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109561219
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Cytokines
   109561219
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 109561219
NCBI-ProteinID: XP_019819168
LinkDB
Position
7
AA seq 144 aa
MSSLSILHLLLLLLALHAPQAKGLPVVTSRTPYSMLMKEIMDDLKKITPSPEGSLNSDEK
NFLTKESLLQANLKVFMTFATDTFGSDSKIMKNLKEFQPVLPTATPTEDPIFIENKNLGD
FRMKLEEYLVIIRNYLKSKNIWFS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagtctctccatcttgcacctgcttctgctcctgcttgcactccatgctcctcag
gcaaaggggttgcctgtcgtgacatcgaggactccatattctatgttgatgaaggaaatt
atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag
aatttcctgacgaaagagagccttctgcaggcaaacctgaaagtattcatgacatttgcc
acagatacttttggaagcgattcaaaaatcatgaaaaatcttaaggaattccagccagtg
ctgcccacagccacacccacggaagatccaatttttattgagaacaagaacttgggcgat
ttccggatgaaattggaagaatatttggttatcattagaaactatctgaagtccaagaac
atatggttttcctaa

DBGET integrated database retrieval system