KEGG   Bos indicus (zebu cattle): 109561426
Entry
109561426         CDS       T04792                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04062  Chemokine signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04630  JAK-STAT signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05223  Non-small cell lung cancer
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561426 (JAK3)
   04151 PI3K-Akt signaling pathway
    109561426 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109561426 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109561426 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    109561426 (JAK3)
   04659 Th17 cell differentiation
    109561426 (JAK3)
   04062 Chemokine signaling pathway
    109561426 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561426 (JAK3)
   05203 Viral carcinogenesis
    109561426 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    109561426 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    109561426 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561426 (JAK3)
   05161 Hepatitis B
    109561426 (JAK3)
   05162 Measles
    109561426 (JAK3)
   05169 Epstein-Barr virus infection
    109561426 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109561426 (JAK3)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109561426 (JAK3)
Protein kinases [BR:biu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   109561426 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo APH
Other DBs
NCBI-GeneID: 109561426
NCBI-ProteinID: XP_019819423
UniProt: A0A6P5C1T5
LinkDB
Position
7
AA seq 1104 aa
MAPPSEETPLISQRSCSLSSSEAGALHVLLPPRGPGPPQCLSFSFGDHSAEDLCVCAAKA
SGILPVYHSLFALALEDLSCWFPPSHIFSVEDTGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLTSAILDLPVLEHLFAQHRHDLVSGRLRVGLSLKEQGECLSLAVLDLARMALEQAQR
PEELLKTVSYKVCLPPGLRDLIQGLSFVTRRRIRRTVCRALRGVATCQADRHSLMVKYIM
DLERLDPDRAAETFRVGLPGAAGGQDTPGLLRVAGGSGIAWSPGEHEVLQPFCDFPEIVD
ISIKQAPCIGPAAEHRLVTITRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSRHYFC
REVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSYLLTVCVLTP
LGPDYKGCLIRCDPTGTFSLAGLGRSHSSLRELLAACWNGGLHVDGVELYLTFCCNPRPK
EKSNLIVVRRGCNPPTSSPVQPQFQCQLSQMTFHKIPADSLQWHENLGHGSFTKIYRGCH
HEIVDGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVRLGALDTYLRKCGHLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGT
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTVPISTLEPAKKLQFYQERQQLPAPKWMELALLIQQCMAYEPGQRPSFRAVIRDLNSL
ITSDYELLSDPTPGTLAPRDGLWNGTQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPEQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSCRCLHRDLAARNILVESE
THVKIADFGLAKLLPLDKEYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYSDKNCSPSAEFLRMMGCERDVPALCRLLELLAEGQRLPAPPACPSEVHELMKLCWAP
NPQDRPSFSALGPQLDALWSGSRG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacacccctgatttctcagcgctcctgcagcctctcctct
tcagaggctggtgccctgcatgtgctgctgccccctcggggccctggacccccacagtgc
ctgtccttctcctttggggaccactcagctgaagacctgtgtgtttgcgctgctaaggcc
agtggcatcctgcccgtgtaccactccctctttgctctggctttggaagacctgtcctgc
tggttccccccaagccacatcttctccgtggaggacacgggtacccaggtcctcgtctac
aggctccgcttttacttccctaactggtttggactagagaagtgccaccgatttgggcta
cgaaaggacttgaccagcgccatcttggatctgccagtcctggagcacctctttgctcag
caccgccatgacctggtgagcggccgcctccgggtaggcctcagcctcaaggaacagggt
gagtgtctcagcttggctgttctggacctggcccggatggccctcgagcaggctcagcgg
cccgaggaattgctgaagacggtcagctacaaggtctgcctgccccctggcctacgcgac
ctgatccagggtttgagcttcgtgactcggaggcgcatccgaaggacagtgtgccgggcc
ttgcgcggggtggcgacctgccaggctgacaggcactcgctcatggtcaagtacatcatg
gacctcgagaggctggatccagacagggctgccgagaccttccgcgtgggtctccccggc
gctgctggtggtcaggatacgccggggctgctccgtgtggctggtggcagtggcatcgcc
tggagcccaggagaacacgaggtcctccagcccttctgcgactttccagaaatcgtggat
atcagcatcaagcaggcgccgtgcattggcccggctgccgagcaccgcctggtcaccatc
accaggacagacaatcagatcctggaggccgagttcccggggcttcccgcagcgttgtcc
ttcgtggcgctcgtggatggctacttccggctgaccacggactcgaggcactacttctgc
agggaggtggcgccgccgcggctgctggaggaggtggctgagcagtgccatggccctatc
accctggattttgccatcaacaaactcaagactgggggctcacttcccggctcctacgtc
ctccgccgcagtccccaggatttcgacagctacctcctaactgtttgtgtcctgaccccc
ctggggccggattataagggctgcctcatccggtgcgaccccacaggaaccttctccctg
gctggccttggccgttcccacagcagtcttcgagagctcctggcagcctgttggaatggt
gggttgcacgtggatggggttgagctgtacctcaccttctgctgcaaccccagacctaaa
gaaaagtccaatctgattgtggtccggagaggctgcaacccacccacatcatcccctgtt
cagccccaattccagtgccagctgagtcagatgacgtttcacaagatccctgctgacagc
ctgcagtggcatgagaacctaggtcacgggtccttcaccaagatttatcggggctgtcac
catgagattgtggatggggaggcccgcgagacagaggtactgctcaaagtgatggatgcc
aagcacaagaattgcatggagtcattcctggaagcagcgagcttgatgagccaagtgtca
taccagcatctcgtattgctccacggcgtgtgcatggctggagacagtatcatggttcag
gaatttgtacgcctgggagcactggacacatatctacgcaagtgtggccacctagtgcca
gccagctggaagctacaggtgatcaaacagctggcctatgccctcaactatctggaagac
aaaggtctccctcatggcaatgtctcagcccggaaggtgctcttggctcgtgaggggact
gatgggaacctgcctttcatcaagctgagtgacccgggtgtcagccccactgtgctaagc
ctggagatgctcactgacaggatcccctgggtggcccctgaatgtctccaggaggcccga
acacttggcttggaagctgacaagtggggctttggagccacagtctgggaggtgttcagt
ggtgtcacagtgcccatcagcaccctggagcctgccaagaagctccagttttaccaggaa
cggcagcagttgcctgcccctaagtggatggagctggccctgctgatccaacagtgcatg
gcctatgagccaggccagaggccctctttccgtgctgtcatccgtgacctgaacagcctc
atcacttcagattatgagctcctctcagaccccacacctggcaccctggcgccccgtgat
gggctctggaatggtacccagctctacgcctgccaggaccctaccatctttgaagagaga
cacctcaaatacatctcacagctgggcaagggcaactttggcagcgtggaactgtgccgc
tacgacccgctgggcgacaacacaggggccctggtggccgtgaagcagttgcagcatagt
gggccagaacagcagagggacttccagcgggagatccagatcctcaaagccctccacagt
gacttcattgtcaagtaccggggtgtcagctatggcccaggccgccagagcctgcggttg
gtcatggagtatctgcccagtggctgcctgcgcgacttcctgcagcggcaccgcgcccgc
ctcgacgctggccgcctgctcctctaygcctcacagatctgcaagggcatggagtacctg
ggctcctgccgctgcctgcaccgcgacctggcagcccggaacatcctggtggaaagcgag
acgcacgtcaagatcgccgacttcggcctcgccaagctgctgcctctcgacaaagagtac
tacgtggtccgcgagccaggccagagccccatcttctggtatgccccagagtccctctcg
gacaacatcttctcgcgccagtcggatgtctggagcttcggggtcgtcctgtacgagctc
ttcacctacagtgacaagaactgtagcccctcagccgagttcctgcggatgatgggatgt
gagagagatgttccagccctctgccgcctcctggagctgctggctgagggccagaggctg
cccgcacctcccgcctgtcctagtgaggttcatgagctcatgaagctgtgctgggcccct
aaccctcaagaccggccatcattcagtgccctgggcccccagctagatgcgctgtggagt
ggaagccggggatag

DBGET integrated database retrieval system