KEGG   Bos indicus (zebu cattle): 109561526
Entry
109561526         CDS       T04792                                 

Gene name
CALR
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04141  Protein processing in endoplasmic reticulum
biu04145  Phagosome
biu04612  Antigen processing and presentation
biu05142  Chagas disease
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109561526 (CALR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109561526 (CALR)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109561526 (CALR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561526 (CALR)
   05170 Human immunodeficiency virus 1 infection
    109561526 (CALR)
   05168 Herpes simplex virus 1 infection
    109561526 (CALR)
   05163 Human cytomegalovirus infection
    109561526 (CALR)
   05169 Epstein-Barr virus infection
    109561526 (CALR)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109561526 (CALR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109561526 (CALR)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:biu04091]
    109561526 (CALR)
Chaperones and folding catalysts [BR:biu03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   109561526 (CALR)
Lectins [BR:biu04091]
 Calnexin / calreticulin
  109561526 (CALR)
SSDB
Motif
Pfam: Calreticulin MDM10
Other DBs
NCBI-GeneID: 109561526
NCBI-ProteinID: XP_019819603
UniProt: A0A6P5C2A6
LinkDB
Position
7
AA seq 417 aa
MLLPVPLLLGLLGLAAADPTVYFKEQFLDGDGWTERWIESKHKPDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPAGLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPNN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDDRAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPEYKGIWIHPEIDNPEYS
PDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLHEEEEEKKGKEEEEADKDDDEDKDEDEEDEDEKEEEEEEDAAAGQAKDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgctgctacccgtgccgctgctgctcggccttctcggcctggccgccgctgatcccacc
gtttactttaaggagcagtttctggacggagacgggtggaccgagcgctggatcgaatcc
aagcacaaaccggattttggcaaattcgttctcagttccggcaagttctatggtgaccaa
gagaaagataaaggcctgcagactagccaggatgcccggttctacgctctgtcggccaga
tttgagcccttcagcaacaagggtcagacgctggtggtgcagttcacagtgaaacacgag
cagaacatcgactgtgggggcggctatgtgaagctgtttccagctggtttggatcagaca
gacatgcacggagactccgaatacaacataatgtttggcccggacatctgtggccctggc
accaagaaggttcatgtcatcttcaactacaagggcaagaatgtgctgatcaacaaggat
atccgctgcaaggacgatgaattcacccacctgtacacgctgattgtgcggcctaataat
acctatgaggtgaagattgacaacagccaggtggagtcaggctccttggaggacgattgg
gatttcttgccacccaagaagataaaggatcctgatgccgctaagcctgaagactgggac
gatcgcgccaagatcgatgaccctacagactccaagcctgaggattgggacaagcctgag
cacattcctgaccctgatgctaagaaacctgaggactgggatgaagagatggacggagag
tgggaaccacctgttattcagaacccagagtacaagggggagtggaaacccaggcagatc
gacaacccagagtacaagggcatttggatccatccagagattgacaaccctgagtattcc
cctgacagcaacatctatgcctatgaaaacttcgctgttctaggcttggatctttggcag
gtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaagcgtatgctgag
gagtttggcaacgagacgtggggtgttacaaaggcagcagaaaagcaaatgaaggacaag
caggatgaagagcagaggctacatgaggaggaggaggagaagaaaggcaaggaggaggaa
gaggcagacaaagatgatgacgaagacaaggatgaggatgaggaggatgaagatgagaag
gaagaggaggaggaagaagatgctgccgctggccaggccaaggatgagctgtag

DBGET integrated database retrieval system