KEGG   Bos indicus (zebu cattle): 109561621
Entry
109561621         CDS       T04792                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor isoform X1
  KO
K05079  erythropoietin receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109561621 (EPOR)
   04151 PI3K-Akt signaling pathway
    109561621 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109561621 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561621 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561621 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109561621 (EPOR)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  Prolactin receptor family
   109561621 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 109561621
NCBI-ProteinID: XP_019819767
UniProt: A0A6P5C3K6
LinkDB
Position
7
AA seq 508 aa
MYHLPAPLRAGIGFLCLLLAGAAWAPPPNPTDPKFENKAALLTAREPDEFLCFTERLEDL
VCFWEEAATAGVGPDNYSFSYQLEGEPWKPCRLHQAPTARGLVRFWCSLPTADTSSFVPL
ELHVTAASGASRYRRTIHVNEVVLLDPPARLVARRADEGGHVVLRWLPPPGAPMASLIRY
EVNISAENAAGSAQRVEILDGRTECLLSNLRGGTRYTFMVRARMAEPSFGGFWSAWSEPA
SLLTASDLDPLILTLSLVLVLILLLLAVLALLSHRRTLKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQTDGCLWWSPSTPLPEDPPAPLEVLSECCWGVTQAVEPGADDGGPLLEPVG
SEHAQDSYLVLDKWLLPRSPPSEDLLQPGGDMDIVTMDEASEASSCTSALALKPGPEGAS
ATSFEYTILDPSSQLLRPRALPPELLPTPPHLKYLYLVVSDSGISTDYSSGGSQEAQGGS
SNGPYSNPYENSLIPAPKPSPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtatcatctcccggcacccctccgggctggaattggcttcctctgcctcttgctcgct
ggggcagcctgggctcccccacccaatccaacggaccccaagtttgaaaacaaagcggcc
ctgctgacagcccgcgagcctgatgagtttctgtgcttcaccgagcgcttggaggatttg
gtgtgtttctgggaggaagcggccaccgccggagtcggcccagacaactacagcttctct
tatcagctcgagggtgagccgtggaagccatgccgcctgcatcaggcacccaccgcccgc
ggcttggtgcgtttctggtgctcgctgcctacagccgacacgtcgagcttcgtgccccta
gagctgcacgtcactgcggcctcgggcgcttcacgctaccgccgtaccattcacgtcaac
gaagtggtgctcctagaccctcccgccaggcttgtagctcggcgggccgacgagggcggc
cacgtggtactgcgctggctcccgccgcctggggcacccatggcgagccttatccgctat
gaggtgaatatctcggcagagaacgccgcagggagcgcacagagggtggagatcctcgac
ggccgcaccgagtgcttgctgagcaacctgcggggcggaacgcggtacaccttcatggta
cgcgcgcgtatggccgagcccagcttcggtggcttctggagcgcctggtccgagcccgcg
tcactgctgacggctagtgacttggaccccctcatcctgacgctctccctcgtcctcgtg
ctcattctgctgctgctggccgtgctggccctgctatcccaccgccggactctgaagcag
aagatctggcctggcatcccaagccctgagagcgagtttgaaggcctcttcacaacccac
aagggtaatttccagctgtggctgtaccagactgacgggtgtctgtggtggagccccagc
acccccctcccagaggacccacctgcccccctggaagtcctctctgagtgctgctggggg
gtgacacaggcagtggaacctggggcagatgacggggggcccctcctggagccagtgggc
agcgagcatgcccaagacagctacctggtactggacaagtggttgctgccccggagtccg
ccgagcgaggatctcctgcagcctggtggcgatatggacatagtgaccatggatgaagcc
tcagaagcgtcctcctgcacatccgctttggccctgaagcctgggccggagggggcctct
gctactagctttgagtacaccattcttgaccccagctcccagctcttgcgcccaagggca
ctgccccctgagctgctccccaccccaccccacctaaagtacctgtacctcgtggtgtct
gactctggcatctcaactgactacagctcagggggttcccaggaagcccaggggggttca
tccaatggtccctactccaacccttatgagaacagcctcatcccagcccccaagccttca
cccccaagctacgtggcctgctcctag

DBGET integrated database retrieval system