KEGG   Bos indicus (zebu cattle): 109561648
Entry
109561648         CDS       T04792                                 

Gene name
FCER2
Definition
(RefSeq) low affinity immunoglobulin epsilon Fc receptor isoform X1
  KO
K06468  low affinity immunoglobulin epsilon Fc receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
biu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109561648 (FCER2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109561648 (FCER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109561648 (FCER2)
   04091 Lectins [BR:biu04091]
    109561648 (FCER2)
CD molecules [BR:biu04090]
 Proteins
  109561648 (FCER2)
Lectins [BR:biu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    109561648 (FCER2)
SSDB
Motif
Pfam: Lectin_C CENP-F_leu_zip
Other DBs
NCBI-GeneID: 109561648
NCBI-ProteinID: XP_019819817
UniProt: A0A6P5C3R9
LinkDB
Position
7
AA seq 388 aa
MTPHSRAEGRGPGPAMGQQEFTKFSRRRRPCCSRGTQLALLALVTTALWAGLLTLLLLWH
WENARNLKQLEETAALNVSQVSKDLERQKGDQMAQKSQAAQMMQDMERIQTEQKRMESQE
SELSWNLDGLRADLSDLKSRGLNEMRQALDSLGRLQEEVGKLWIELRAANAQPPGEMLPP
TLSVVPTAPAIALSMVPNTASTLVPTTTTSTTAPTMVPSTTATTTAPTMVPSTTATTTAT
TMVPTTAAPLSLSSTPGSVCNTCPEAWIYFQKKCYYFGEGAKKWIQARYACENLHGRLVS
IHSPEEQDFLTKRANWRGSWIGLRDLDIEGEFIWMDNQPLDYSNWQPGEPNDAGQGENCV
MMLGSGKWNDAFCGSELHGWVCDRLATC
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgactcctcacagccgggctgaggggaggggacccgggcctgcaatggggcagcaagaa
ttcacgaaattttccagaaggcggaggccgtgctgctctaggggaacgcagctggccctg
ctggcactggtgacgacggcgctatgggctgggctgctgactctgcttctcttgtggcac
tgggaaaatgcacgaaatctaaaacagctggaggagaccgctgccctgaatgtctctcag
gtgtccaaagacttggaaagacaaaagggtgaccagatggcccagaaatcccaggctgcc
cagatgatgcaggacatggaacgaatccaaactgaacagaagagaatggaatctcaggag
tctgagctctcctggaacctggatggtcttcgagctgacctgagtgacctgaagtcccgc
ggcttgaatgagatgcgtcaggccttggattcactgggaagactccaagaggaggtggga
aagttgtggatcgagctacgcgctgccaacgcccagcccccaggagagatgctgccaccc
actttgtctgtggtacccacggcacccgccattgcgctctccatggtacccaacacagca
tccaccttggtacccacgacaacaacatccactacagcacccaccatggtgcccagcacc
acagcaactacgacagcacccaccatggtgcccagcaccacagcaactacgacagcaacc
accatggtgcccaccacggctgcccccctcagcctctcctccaccccaggctctgtgtgc
aacacgtgccccgaggcatggatctatttccaaaagaagtgctactacttcggggagggc
gccaagaaatggatccaggcccggtacgcctgtgaaaatctgcacgggcggctggttagc
atccacagcccagaggagcaggacttcctgaccaaacgtgccaactggaggggctcctgg
attggccttcgggacctggacattgaaggggagtttatctggatggacaaccagcccctg
gactatagcaactggcagccaggggagcccaacgatgcaggccagggtgagaactgcgtg
atgatgctgggctctgggaagtggaatgacgccttctgtggaagcgaacttcatggctgg
gtgtgcgaccggctggccacgtgctga

DBGET integrated database retrieval system