KEGG   Bos indicus (zebu cattle): 109561797Help
Entry
109561797         CDS       T04792                                 

Gene name
DOT1L
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00310  Lysine degradation
biu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109561797 (DOT1L)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    109561797 (DOT1L)
Enzymes [BR:biu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109561797 (DOT1L)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109561797 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 109561797
NCBI-ProteinID: XP_019820094
LinkDB All DBs
Position
7
AA seq 1713 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVVFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKVP
ESKAAVPADTPVDSGAEEEKAGTATVKKPSPSKARKKKLNKKGRKMVGRKRGRPKKMSAT
NPERKPKKTQSSLDLLHAQTXSRAASPLPQDAHRPPHSPFYQLPPSVQRPTPEQLLLAPT
PPALHRLLESFRIQYLQFLAYTKTPQYKASLQQLLDQEKEKNARLLGAAQQLFGHCQAQK
EEIKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQTEQLEKGNWELRSQSLRLL
KARCEELKLDWSTLSLENLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDEALALQLRGKPEAEPSRLHLELDCARFSLPPFSSLSPELSMNGHAAGYELCSAL
GRPSPKQNTPQYLASPLDQEVVPCTPSHSGRPRLEKLSSLALPDYTRLSPAKLVLRRHLS
QDHAASGKAAASELHPRAEHAKENGLPYQSPGITNGIKLSPQDPRPSSPTALQMGEKGPE
KGVKERAYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRAEKARSTPSPGPPA
RESSSTLEKQVAANTHGAGGNAAGSKSLALAPTGFAYAGSVAISGALAGSPAPLAXGAEP
PALDESSSSGSLFATVGSRSSTPQHPPLLTQPRTCGSASPAPQLCSSPRLGALGPLPDSG
KGDLPCEASFSDPESEAKRRIVFTISAGASSTKQSPSSKHSPLPSGARGDGGQGHGPDGR
KRGRRKRASAGTPSLSSSVSPKRRALPSVAGLFTQSSGSPLNLNSMVSNINQPLEITAIS
SPESSLKSSPVPYQDNDQPPVLKKEKPLSQTNGAHYSPLTSDEEPGSEDEPGSARIERKI
ATISLESKSPPKTLENGGSLAGRKAPLASEPVNSSKWKSTFSPISDLGLAKAADSPLQAA
SALSHNSLFAFRPGLEEPSAADAKLATHSRKSFPGTLPGAGGLSPSSLPASGFALGGGLA
ADLSLHSFSDGASLSHKAPEAAGLGAPLSFPGPRGKEGGAAESGPFVNKRQLDGLGPKGE
GGLPTCGPPDKASTAHSKAGKGREREPDVKNGHNLFMAAATAPPAGLLSGPGLAPAASSA
GGAAPSVQTHRPFLGAFAPGPQFALGPMSLQANLGPSVLQSLFSSVPAAGLVHVSTAATR
LTNSHAMGSFSSGVAGGAVGGVFNHAVPPASAHPFGASFGSGAACRSATLSLTPLQAVAS
TPASSFQAPSSAEPRPPPPPPHLXXPPPGQPALHAPPHPNATLPPPPALLPANSEPVLLQ
NLVSLPANQAFLPASSAASLPPANASLSIKLASLPHKVSRPSLTVHHQPLPGLALAQAAP
VNPQASSTGPPAVWVSLGMPPPYAARLAGVKPR
NT seq 5142 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgaggctcaagtcgcccgtgggggccgagcccgccgtctac
ccgtggccgctgccggtctacgacaaacaccacgatgctgctcatgaaatcatcgagacc
atcagatgggtctgtgaagaaatcccggatctcaagcttgctatggagaattacgtttta
attgactacgataccaaaagctttgagagtatgcagaggctctgtgacaagtacaaccgg
gccatcgacagcatccaccagctgtggaagggcaccacacagcccatgaagctgaacaca
cggccatccacggggctcctgcggcacatcctgcagcaggtctacaaccactcagtgacc
gaccctgagaagctcaacaactacgagcccttctccccagaggtgtatggggagacctcc
ttcgacctggtcgcccagatgatcgatgagatcaagatgaccgaagatgacctgttcgtg
gacctgggcagtggagtgggccaggttgtgctgcaggttgccgcggccaccaactgcaaa
catcactacggtgtagagaaagctgacatcccagccaagtacgcggagaccatggaccga
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacactggagagg
ggggacttcctctcggaggagtggagagaacggattgctaacacaagtgttgtatttgtg
aataactttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcgaagccctttgcgcctctgaacttcagaataaac
agtagaaacttgagtgacatcggcaccatcatgcgcgtcgtggagctgtcgccgctaaaa
ggctcggtgtcatggacggggaagccagtctcctactacctgcacaccatcgaccgcacc
atacttgaaaactatttttctagtctaaaaaatccaaaactcagggaggaacaagaggca
gctcggcgccggcagcagcgggagaacaagagcaacacaaccacgcccaccaaggtgccc
gagagcaaggcagctgtgccggcggacacccccgtggactctggtgctgaggaggagaaa
gccgggacggccactgtcaagaagccatctccctccaaggcccggaagaagaagctgaac
aagaagggccggaagatggtgggtcggaagcgtgggcgccccaagaagatgagtgccacc
aaccccgagcgcaagcccaagaagacccagagctcactggacctgctgcacgcccagacc
rcgtcacgagcggcctcccccttgccgcaggacgcgcacaggccacctcacagcccattc
taccagctacctcccagcgtgcagcggcctacccccgagcagctgctgctggcacccacc
ccgcccgcactgcacaggctgctagagtccttcaggattcagtacctacagttcctggca
tacacgaagacccctcagtacaaggccagcctgcagcagctcctggaccaggagaaggag
aagaatgcccggttgctaggcgcagcgcagcagctatttggccactgccaagctcagaag
gaggagatcaagaggctcttccagcagaaactggacgagctgggagtgaaggcgctgacc
tacaacgacctgatccaagcgcagaaggagatctcggctcacaaccagcagttgagggag
cagacggagcagctggagaagggcaactgggagctgaggagccagagcctgaggctgctc
aaggcacgatgcgaggagctgaagctggactggtccacgctgtcgctggagaatctgctg
aaggagaagcaggccctgaagagccagatctcagagaagcagaggcactgcctggagctg
cagatcagcatcgtggagctggagaagagccagcggcagcaggagttgctgcagctcaag
tcctgcgtgccgcctgatgaggcactggctctgcagcttcgtgggaagccagaggctgag
cctagccggctgcacttggagctggactgcgcccgcttctccctgccacccttcagcagc
ttgagccccgagctctctatgaatggccacgcagccggctatgagctctgcagcgcactg
ggtcggccctcgcccaagcagaacaccccccagtacctggcctccccgctagaccaggag
gtcgtgccctgcacccctagccacagcggccggccacggctagagaagctgtccagcctg
gccctgcctgactacaccaggctatcccctgccaagctggtgctgcggcgccacctgagc
caggaccacgcggccagtggcaaggcagctgccagtgagctgcacccacgagccgagcat
gccaaggagaatgggctcccttaccagagccctggcatcactaatggcatcaagctgagc
ccacaagacccccgaccttcatcccccacggctttacagatgggagagaagggccccgag
aagggtgtgaaggagcgtgcctacgccagcagtggggaggccatcaccagcctgcccgtc
agcatcccgctgagcaccgtgcagcccagcaagctgcccgtcagcatccccctggccagc
gtggtgctgcccagccgcgccgagaaggcgagaagcacacccagccctgggccaccggcc
cgagagtcctcatccacgctggagaagcaggtggctgctaacactcatggtgccgggggc
aacgctgctgggagcaagagcctcgccctggctcccacaggctttgcatacgccggctcg
gtggccatcagtggggccctggccggcagcccggcacccctcgccyctggagccgagccc
ccagccctggacgagtcctccagctctggaagcctctttgccaccgtggggtcccgcagc
tccaccccgcagcacccacccctgctgacgcagccacgcacctgtggctcggcctcgcca
gccccccagctctgctccagcccccggcttggcgctctgggcccactccccgactctggc
aaaggggacctgccctgcgaggccagcttctcagaccctgagagcgaagccaaaaggaga
atcgtcttcaccatctcggcgggcgccagcagcaccaagcagtcaccttccagcaaacac
agccctctgccgtcgggtgcccgcggggacggtggccagggccatgggccagacggccgc
aagcggggccggaggaagcgggcatcggcggggacccccagcctgagctcgagtgtgtcc
cccaagcgccgggccttgccatctgtcgctgggcttttcacgcagtcttcagggtccccc
ctgaacctcaactccatggtcagcaacatcaaccagcccctggagatcacagcaatctcg
tcccctgagagctccytaaagagctcacccgtcccctaccaggacaacgaccaaccaccc
gtgctcaagaaggagaagcccctgagccagaccaatggtgcccactactccccactgact
tcggacgaggagccaggctctgaggatgagcccggcagtgccagaattgagagaaaaatt
gcaacgatctccttagaaagcaagtctccgccaaaaaccttggaaaatggtggcagccta
gcaggaaggaaggcgccgctggccagcgagccggtcaacagcagcaagtggaagtccacc
ttctcacccatctccgacctgggcctggccaaggcggccgacagcccgctgcaggctgcc
tctgctctgagccacaactctctgttcgctttccggcctggcctggaggagcccagtgcg
gccgatgccaagctggccacccactccaggaagagcttcccgggcaccctgccaggggcg
ggcgggctgagccccagtagccttcctgccagcggcttcgccctgggcgggggcctagca
gctgacctcagtttacacagcttcagtgatggtgcttctctctcccacaaggcccccgag
gcagctggcctgggtgcccccctgagcttccccggcccacggggcaaagagggtggcgct
gcagagtctggccccttcgtgaacaagcggcagctggacggactgggcccaaaaggcgag
gggggccttcccacatgcggacccccggacaaggcctccacagcgcatagcaaggcaggc
aagggccgcgagcgcgagcctgacgtcaagaacggccacaacctgttcatggccgctgcc
actgcgccccctgcaggcctcctcagcggcccaggtcttgccccagcggcatcctcggca
ggtggcgcagccccgtccgtgcagacccaccgccccttcctgggcgccttcgcccccggg
ccacagttcgcactgggccccatgtcgctacaggccaacctgggcccatctgtgctgcag
tccctgttcagttccgtgcccgccgccggcctggttcacgtctcgaccgccgccaccaga
ttgaccaactcgcacgccatgggcagcttctcctctggggtggccggcggcgcagttgga
ggtgtctttaaccacgcggtgcctcccgcctccgcccatccgttyggagccagtttcggc
agtggggctgcatgtcgcagcgccacgctgagcttaaccccgctgcaggcggtggccagc
accccggcctcttcctttcaggccccgtcctctgcggagccgaggccacccccaccccct
ccgcacctggnnnnaccccctccggggcagcccgccctccacgcaccccctcatcctaac
gccaccttgcctcctccccctgcgctgctcccagctaactctgagcccgtgcttctgcag
aacctcgtatccctccctgctaaccaagctttcttacccgcctcctctgccgcctctctg
ccgcctgctaacgcctctctgtccatcaagctcgcctccctcccgcacaaggtgtcccgg
ccctccttgacggtgcaccaccagcccctgcctgggctggccctggcccaggccgcgccc
gtgaacccacaggccagctccacggggccgcccgccgtgtgggtttcccttggcatgccg
cctccgtatgccgcgcgccttgcgggggttaagccgcgataa

DBGET integrated database retrieval system