KEGG   Bos indicus (zebu cattle): 109561990
Entry
109561990         CDS       T04792                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2
  KO
K02085  adenomatosis polyposis coli protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04810  Regulation of actin cytoskeleton
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109561990 (APC2)
   04390 Hippo signaling pathway
    109561990 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109561990 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109561990 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561990 (APC2)
   05206 MicroRNAs in cancer
    109561990 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109561990 (APC2)
   05225 Hepatocellular carcinoma
    109561990 (APC2)
   05226 Gastric cancer
    109561990 (APC2)
   05217 Basal cell carcinoma
    109561990 (APC2)
   05213 Endometrial cancer
    109561990 (APC2)
   05224 Breast cancer
    109561990 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109561990 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    109561990 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109561990 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109561990 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109561990 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109561990 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109561990 (APC2)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109561990 (APC2)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109561990 (APC2)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     109561990 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC Arm_APC_u3 APC_r Suppressor_APC Arm SAMP bZIP_1 Sec2p HALZ Herpes_BLRF2
Other DBs
NCBI-GeneID: 109561990
NCBI-ProteinID: XP_019820435
UniProt: A0A6P5C4D9
LinkDB
Position
7
AA seq 2299 aa
MTSSVAAYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKAVLQHLQGKLEXE
ARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPALAPEPTTRTPEGSPVHSSGPSKENF
GELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETFSMQMD
LIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLSAQDRVQQTEPQAL
LAVKSMPMDEDAENEVPTHPEDGAPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSSS
PESCVAMRRSGCLPLLLQILHGTEAGAGGHXXTPGAPGAKDARMRANAALHNIVFSQPDQ
GLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPEGSGTGAAPVPIEPQICQATCAVMKL
SFDEEYRRAMNELGGLQAVAELLQVDHEMHKMTRDPLNLALRRYAGMTLTNLTFGDVANK
AALCARRGCMEAIVAQLASESEELHQVSGGCGNTGGRGKVEGIPWGFAVCQLLQALRVGA
WPRPTLPALPRPQVVSSILRNLSWRADINSKKVLREVGSMTALMQCVLRATKESTLKSVL
SALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLIATR
EDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSPRDQELLWDLGAVGMLRN
LVHSKHKMIAMGSAAALRNLLAHRPAKYQPAATAVSPGSCAPSLYVRKQRALEAELDTRH
LAQALDHLEKQGLPEAETACKKPLPPLRHLDGLAQDYASDSGCFDDDDAPSLAAAATAAE
PASPAVLSLFLGSPFLQGQALARAPPTRRGGLEVEKEAGGEAAVAARAKAKLALAVARID
RLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGPEGGRREAGSSRAHPLLR
LKAAHASLSNDSLNSGSTSDGHCPREHSRPCSLAALAEHREGPPRGQARPSRLDLNLPGG
QAEPEARDAKATDAHVRTIKLSPTYQHVPLLEGTTRAGAGSLAPGARKQAWLSTEGLSSV
PEKLVVEKAPLCLSRCSSLSSLSSAGRPGPSEAGDLDESDSSLEGLEESGPGETELDGAW
RGPGAASLPMAIPAPQRGRGLGVEDATPSSSSENCVQETPLVLSRCSSVSSLGSFESPSI
ASSIPSDPCSGLGSGTVSPSELPDSPGQTMPPSRSKTPPLAPAPPGEREATQFSLQWESY
VKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLSALALHELYVQKDVELRL
LPPACPERGSGGGGGPGHRRRDEASGCLEGPASTDQELELLRECLGGAVPARLRKVASAL
VPGCRTLPVPVYMLVPAPAREDDSCTDSAEGTPVNFSSTASLSDETLQGPPKDGGRLDGK
KPVGRAASTRQSAGQRHRVGGMGRSTEQPRGAGSGRAGLELPLRRPPSTCRDTDSSRPGQ
EHGDGALQSLCLTTPTEEAVYCFYGNDSDEEPATAVAAAPPRRASAIPRAVKRERPTGAR
KEVQAVPKAAPKAAPPARAQPSLIADETPPCYSLSSSASSLSEPEPSECMASRPRVHKPG
LTKDLVPGGRKDGCPSPRAEAELLRRCIGSALPRRQPQVSGPRRRPPREAQPKARAAEGP
RERGEEAASSDHASDLDSIEWRAIQEGANSVATWLHQAAAAAAREASSESDSVLSFATGQ
SVGSTLQPTVHRKGCRPRAERQAGGALRPEKPEGALTQRSSGPEKPRGTQKAPNGVPAVL
RGHTVIYMPTPATRAQPRGAPGSRIVARKMGAPSPVQPAAPTKAPNPGQQRSRSLHRPGK
ISELATLSPPQRSATPPARLAKTPSSSSSQTSPASQPLPRRSPPAAQPAGPLPGPRASPV
PKTXXRALLAKQHKTQKSPVRIPFMQRPARRGPPPLARAAPEPGPRGRVGAEGGSAARGG
RLGLVRVASARSSGSESSDRSGFRRQLTFIKESPGLMRRRRSELSAPEATNPTTQAASPC
RGRPALPAVFLCSSRCDELRAGSRQAPAPQRAHTARPRPSERQPRRTSSESPSRLPVRTP
AAGPETVKRYASLPHISVARRPDATIPEPAADATRRSSAGEAGPLPRVAAPETXWRRIRD
EDVPHILRSTLPARALPLLGSPPEDGPAGPPQRKTSDAVVQTEDFAAAKTNSSTSPSMES
RAPPEATAGGPTSLLGSDVDGPPSKAPAPIPFVPASRHGSPSRSARVPPFNYVPSPMVAA
TADSTVEKAPTPVPTSLLE
NT seq 6900 nt   +upstreamnt  +downstreamnt
atgacgagctcagtggcagcctatgagcagctggtgcggcaggtggaggccttgaaggcc
gagaacagtcacctgcggcaggagcttcgggataattcaagccacctgtccaagctggag
acagagacgtcgggaatgaaggcggtcctgcagcacttacagggcaagctagagcrggag
gcccgtgtgttggtgtcctccgggcagactgaggtgctggaacagctgaaagccctgcag
atggacatcaccagcctgtataacctcaagttccagcccccagctctggcccctgaaccc
actaccaggacccctgagggaagcccggtgcacagctctgggccctccaaggagaatttt
ggggagctgagccgggccaccattcggctcctagaggaactggaccgggaacggtgtttc
ctgttgaatgagattgagaaggaggaaaaggagaagctctggtattactcgcagttgcag
gggctatctaagcgcttggatgaactcccgcacgtggagacgttctcaatgcagatggat
ctgatccggcagcagctggaattcgaggcccaacacatccgctcgctgatggaggagcgc
ttcggcacctcggacgagatggtgcagcgggcgcagatccgtgcttcccgtctggagcag
atcgacaaggaactgctgtccgcgcaggaccgagtgcagcagaccgagccccaggccttg
ctggcagtgaagtcgatgcccatggacgaggacgctgagaatgaggtccccacgcaccct
gaggatggtgcccctcagccaggcaacagtaaggtggaggtggtcttctggctcctgtcc
atgctggcaacgcgggaccaggaggacacggcgcggacgctgctcgccatgtccagctca
cccgaaagctgcgtggccatgcgccgctcaggctgtctgccgctgctgctgcagatcctg
cacggsactgaggccggggccgggggtcacnnnnggacccccggggctccgggagccaag
gacgcgcgcatgcgtgccaacgcagcgctgcacaatatcgtcttctctcagcccgaccag
gggctagcacgcaaggagatgcgcgtgttacacgtgctggagcagatccgcgcctactgc
gagacctgttgggactggctgcaggcccgggatggcgggcctgagggcagcggcactggt
gctgcgccggtgcccatcgagccacagatctgtcaggccacctgcgccgtgatgaagctg
tcctttgacgaggaataccgccgagctatgaatgagctgggtgggctgcaggcagtggcg
gagttactgcaggttgaccatgagatgcacaagatgacccgggaccctctcaacctggcc
ctgcgccgatacgctggcatgaccctcaccaacctcaccttcggggacgttgccaacaag
gctgcactgtgcgcccgccggggctgcatggaggccattgtggcccagctggcatctgag
agtgaggagctgcaccaggtatcaggaggctgtgggaacactggggggcgggggaaggtg
gagggcatcccctggggctttgccgtgtgccagctgcttcaggccttaagggtgggagcc
tggcccaggcccaccctgcctgccctgccccgcccccaggttgtgtctagcatcctgcgc
aacctgtcctggagggccgacatcaacagcaagaaggtgctgagggaagtgggcagcatg
actgccctgatgcagtgcgtcctgcgagccaccaaggagtccaccctgaagagcgtgctt
agcgccctgtggaacctctcggcgcacagcacggagaacaaggcggccatctgccaggtg
gatggtgccctgggcttcctggtaagcacactgacttacaagtgccagagcaactcgcta
gccatcattgagagcggtggtggcatcctgcgcaatgtgtccagcctcatcgccacccgc
gaggactacaggcaggtgctgcgagaccacaattgcctgcagacgctgctgcagcacctg
acgtcgcacagcctgaccatagtgagcaacgcgtgcggcacgctctggaacctgtcggcc
cgcagcccccgcgaccaggagctgctgtgggacctgggcgccgtgggcatgctgcggaac
ctggtgcactccaagcacaaaatgatcgccatgggcagcgccgccgcgctgcgcaacctg
ctggctcaccggcctgccaagtaccagccagcggccaccgcggtctccccgggctcctgc
gcgcccagcctgtacgtgcgcaagcagcgggcgctggaggccgagctggacacacggcac
ctggctcaggcacttgaccacctggagaagcagggcctgccggaggccgagaccgcctgc
aagaagcccctcccgcccctgcgccacctggacggcctggcccaggactacgcctctgac
tcgggctgttttgacgacgacgatgcgccctccctggctgctgccgccactgccgcagag
cccgccagccccgcagtgctctccctcttcctgggcagccccttcctgcaaggccaggcg
ctggcccgagccccgcccacccgccgaggaggcctggaggtggagaaggaggccggtgga
gaggcagccgtggcagctagggccaaggccaagctggcgctggcggtggcacgcatcgac
aggctggtagaggacatctcggccctgcacacctcatctgacgacagcttcagcctcagc
tccggggaccctggccaggaggccccacgagaaggccgtgcccaatcctgctcaccttgc
agggggcctgagggggggcggcgggaagcaggcagcagccgggctcacccactgctgcgg
ctcaaggcagcccacgccagcctttccaatgacagtctcaacagcggtagcaccagtgat
gggcactgtcctcgcgaacactctcggccctgctcgctggctgctctggccgagcaccga
gaggggcccccacgtggtcaggcgcggcccagccggcttgacctcaacctgcctggaggc
caggctgagcctgaggcccgggatgccaaggccacagatgcccacgtgcgtaccatcaag
ttgtcgcccacctaccagcacgtgccgctgctggagggcaccactagggcgggtgcgggg
tccctggcccctggggcccggaaacaggcctggctgtccacagaaggcctgagcagtgtg
cctgagaagctagtggttgagaaggcacccctctgcctgtcccgctgcagctcgctgtcc
tcactgtcctcagctggccgcccggggcccagtgaggctggggacctagatgagagcgac
tcatccctggaggggctggaggagtctggccctggtgaaacagagctggatggggcctgg
cggggcccaggggccgcctccctgcccatggccatcccagcgccccagaggggtcggggc
ctgggggtggaggatgccacgccgtccagctcctctgagaactgcgtgcaggagacaccg
ctggtgctgagccgctgcagctcagtcagttcactgggcagcttcgagagcccatccatt
gccagctccatccccagtgacccatgcagcgggctgggcagtggcacggtcagccccagt
gagctgcctgatagccccgggcaaaccatgcctccgagccgcagcaagacaccaccgctg
gccccagcaccaccgggcgagcgggaagccacccagttcagcctgcagtgggagagttac
gtgaagcgcttcctggacatcgccgactgccgggagcgctgccggctgccctccgagctg
gacgcaggcagcgtgcgtttcactgtggagaagcccgacgagaacttctcgtgtgcctcc
agcctcagcgcactggccctgcatgagctctacgtgcagaaagacgtggagctgcggctg
ctgccccctgcctgcccagagcgcggcagtgggggaggcggaggcccagggcaccgccga
cgggatgaggccagtggctgtctggaagggccggcgtccaccgaccaggagctggagctg
ctgcgtgagtgcctgggtggggccgtgcctgcccggctccgaaaggtggcctcagcactg
gtgcctggctgccgcacgctgcccgtgccagtctacatgctggtgcctgccccggcccgt
gaggacgactcctgcactgactcggctgagggcactccagtcaacttctccagcaccgct
tccctcagcgaygagaccctgcagggaccccccaaggatggtgggcgtttggatgggaag
aagcccgtgggtcgtgctgcctccactaggcagtctgctgggcagcggcacagggtgggg
ggcatgggccggagcacagagcagccccggggggctggcagtggcagggcagggctggag
ctgcccctccggcggcccccgagcacctgcagggacactgacagctcccgcccaggccag
gagcatggggatggggctctgcagtctctctgcctcacaacgcccaccgaggaggctgtg
tattgtttctatggcaatgactcggatgaggagccggccacagcagtggcagcagcaccc
ccacggcgggcatctgcgatcccccgggcggtcaagagggagcgcccgactggtgccagg
aaggaggtgcaggctgtgcccaaggctgcacccaaggcggcaccgcctgcccgggcccag
cccagcctcattgcagatgagacaccaccgtgctactccctgagctcctccgccagctcc
ctcagcgaacctgagccctccgagtgcatggccagtcggccccgggtccacaagccaggg
ctcaccaaggacctggtccctgggggcaggaaggatggctgccccagccctcgggctgag
gcagagctgctccggcgttgcataggctcagccttgcccaggcgccagccccaggtgtcc
ggcccaaggcgccgcccaccccgagaggcccagccaaaggcgcgtgcagcagaagggccc
cgggagcgcggtgaggaggcggccagctcagaccatgcctcagacctggacagcatcgag
tggcgtgccatccaggagggtgccaactctgttgccacatggctgcaccaggccgcagcg
gcggctgcacgtgaggcctcctcagagtctgattctgttctgtcctttgcaacagggcag
tctgtgggttccaccctgcagcccactgtgcataggaaggggtgtcggccaagggcagag
cgccaagcgggtggtgccctgcggccagagaaaccagaaggggccctcacccagcgcagc
agcgggccggagaagccgcgtggcactcagaaggccccaaatggggtgccggcggtgctc
cggggacatacagtgatctacatgcccaccccggccacccgggcacagcccagaggtgcc
cctggttcccgcattgtggcaagaaagatgggagcgcccagccccgtgcagccggcagcc
cccaccaaagcccccaacccagggcagcagcggtctaggagcctgcaccggcctggcaag
atctcagagctggcaacactcagccccccgcagagaagtgccacaccaccagcccgcctt
gccaagaccccatcgtcaagttcctctcagacctcaccggcctcccagcctctgcccagg
aggtcaccccctgctgcccagcctgcagggcccctgcccggccccagggcctccccagtg
cccaagacnnnnncaagggccctgctggccaagcagcacaagacgcagaagtcacccgtg
aggatccccttcatgcagaggcctgccaggcgggggccgccgcccttggctagggcagcc
ccggagccaggccccaggggccgggtgggcgcagaaggcggctctgcagcccgagggggc
cgcctgggcctggtgcgcgtggcctccgcccgctccagcggcagcgaatcctccgaccgc
tcgggtttccggcggcagctgacctttatcaaggagtcgccgggcctgatgcggcgccga
cgctcggaactgtccgcacccgaagccaccaacccgaccacccaggctgcctcgccctgc
cgcggccggccagcactacccgctgtcttcctctgctcctcgcgctgtgatgagctgcgg
gcaggctcccggcaggccccggccccgcagcgggcccacacggcccggccccgccccagc
gagcggcaacctcggcgcaccagctccgagagcccgtcccgcctgcccgtccgcacgccg
gccgccgggcccgagacggtcaagcgctacgcctccctgcctcacatcagcgtggcccgc
agaccggatgccaccatccccgaacctgcggcggatgccacccgccgcagcagcgcaggg
gaggccgggccgctgcccagggtggccgcgccggaaaccnngtggcgccgcatccgggac
gaggacgtcccgcacatcctgcggagcacgctgcccgcccgcgccctgccgctgctgggc
tccccgccggaggacggcccagccggcccaccacagcgcaagaccagcgacgccgtggtc
cagactgaagacttcgcggctgcgaagaccaactccagcacgtccccgagcatggagagc
agggcgccccccgaggccacggccggcggccccacctcccttcttggcagcgacgtggac
gggccgccctccaaggcgcccgcacccatccccttcgtccccgccagccggcacggctcc
cccagccgctccgcccgtgtcccccctttcaactacgtgcccagccccatggtggcggcc
accgctgactccaccgtggagaaggcccccaccccggtccccaccagcctcctggaatag

KEGG   Bos indicus (zebu cattle): 109564604
Entry
109564604         CDS       T04792                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04810  Regulation of actin cytoskeleton
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109564604 (APC)
   04390 Hippo signaling pathway
    109564604 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109564604 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109564604 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109564604 (APC)
   05206 MicroRNAs in cancer
    109564604 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109564604 (APC)
   05225 Hepatocellular carcinoma
    109564604 (APC)
   05226 Gastric cancer
    109564604 (APC)
   05217 Basal cell carcinoma
    109564604 (APC)
   05213 Endometrial cancer
    109564604 (APC)
   05224 Breast cancer
    109564604 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109564604 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    109564604 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109564604 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109564604 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109564604 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109564604 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109564604 (APC)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109564604 (APC)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109564604 (APC)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     109564604 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 109564604
NCBI-ProteinID: XP_019823567
UniProt: A0A6P5CEW9
LinkDB
Position
10
AA seq 2861 aa
MYTRLCSSAVAALPASVPPCAVRSRSSGGGRGCVRQERKRPGCVRASVRGASVWQEVLKQ
LQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGEC
SPVPMGSFPRRGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRID
SLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRITRIQQIEKDILR
IRQLLQSQATEAERSSQSKHEAGSHEAERQNEGQGVAEINMATSGSGQGSTTRIDHETAS
VLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLL
EQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELG
GLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALV
AQLQSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLS
ALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNE
DHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNL
IHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLS
ETFDNIDNLSPKASHRSKQRHKQNLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTV
LPSSSSSRGSLDSSRSEKDRSLERERGISLGNYHPATENPGTSSKRGLQISTTAAQIAKV
MEEVSAIHTSQEDRSSGSTTELHCGTDERNALRRSSTTHTHANTYNFTKSENSNRTCPIP
YAKVEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHS
ANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHILEDEIKPNEQRQSRS
QSTAYPVYPESTDDKHLKFQPHFGQQECVSPYRSRAANGSETNRVGSNHGISQNVNQSLC
QEDDYEDDKPTNYSERYSEEGQHEEEERPTNYSIKYSEEKHHVDQPIDYSLKYTTDIPSS
QKPAFSFSKNSSGQSTKTEHISSSSENTSTTSSNAKRQNQLHPSSAQSRSGQTPKATSSS
CKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEVGCDQTTQEAESANTLQIAEIK
DNSGPRSNEDSVSKVPAGSQHIRTKSSRLQASGLSSESARHKAVEFSSGAKSPSKSGAQT
PKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPG
QTMPPSRSKTPPLPPPPPPQTVQTKQEVPKNKAPSAEKRESGPKQAAVNAAVQRVQVLPE
ADTLLHFATESTPDGFSCSSSLSALSLDEPFIXKDVELRIMPPVQENDNGNETESEQPEE
SNENQEKEAEKPTDSEKDLLDESDDDDIEILEECIISAMPTKSSRKAKKPAQTTSKLPPP
VARKPSQLPVYKLLPSQNRLQAQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIES
PPNELAAGEGVRAGAQSSEFEKRDTIPTEGRSTDEAQRGKASSVTVPELDDSKTEEGDIL
AECINSAMPKGKSHKPFRVKKIMDQVQQASMSSSGTNKNQLDGKTKKPTSPVKPIPQNTE
YRTRVRKXTDSKNNLNAERNFSENKDSKKQHLKNNSKDFNDKLPNNEDRVRGSFTFDSPH
HYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKENKESEAKVTNHTELTSNQ
QSASKTPAVTKQPXNRGQSKPVLQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFS
RNSSLSSLSDIDQENNNNKENEPVKETEPPASQGEPGKPQASGYAPKSFHVEDTPVCFSR
NSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKPDNEKHSPRNMGGILAEDLTLDLKDI
QRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGIS
LGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESENKGIKGGKKVYKSLITGKV
RSNSEISSQMKQPLQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSE
GQPATTSPRGTKPSVKSELSPVTRQASQTAGSNKGPSRSGSRDSTPSRPAQQPLSRPMQS
PGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTG
LSKNGSGIPRSESASKGLNQMSNSNGSNKKVELSRMSSTKSSGSESDRSERPVLVRQSTF
IKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAHTPVLSPSLPDMSLSTHSSVQSGG
WRKLPPNLSPTIEYNDGRPVKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVST
WRRTGSSSSILSASSESSEKAKSEDEKQVNSISGSKQTKENQVSTKGTWRKIKESEISPT
NSTSQTTSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVI
DTVSEKGNPNPKDSKDNQGKQNVSNGSAPTRTMGLENRLNSFIQVDPPDQKGTETKPGHS
NNPVPASETSESSIAERTPFSSSSSSKHSSPSGTVAARVSPFNYNPSPRKSSTDGTSARP
SQIPTPVSNNTKKRDSKPDSTEPSGTQSPKRHSGSYLVTSV
NT seq 8586 nt   +upstreamnt  +downstreamnt
atgtacacccgcctctgctcgagtgcggtcgccgctttgcctgcttcggtaccgccctgt
gctgtccggtcccggagctccggcggcggcaggggctgtgtccggcaggagaggaagcgc
ccgggctgcgtccgtgcttctgtccgcggggcgagcgtctggcaggaagtacttaaacaa
ctacaaggaagtattgaagatgaagctatggcttcttctggacagattgatttattagag
cgtcttaaagaacttaacttagatagcagtaatttccctggagtgaaactacggtccaaa
atgtccctccgttcttacggaagccgagaaggatctgtatctagtcgctcaggagagtgc
agtcctgttcctatgggttcatttccaagaagagggtttgtaaatggaagcagagaaaat
accggttatttagaagaacttgaaaaagagagatcattgcttcttgctgaccttgacaaa
gaagaaaaggaaaaagactggtattatgctcaacttcagaatctcactaaaagaatagat
agccttcctttaactgaaaatttttccttacaaacagatatgaccagaaggcagttggaa
tatgaggcaaggcaaatcagagttgcaatggaagaacaactaggtacttgccaggatatg
gaaaaacgagcacagcgaagaataaccagaattcaacaaatagaaaaggacatacttcgt
atacgacagcttttacagtcccaagcaacagaagcagagaggtcatctcagagcaagcat
gaagcgggctcacatgaagctgaacggcagaatgaaggtcaaggagtggcagaaatcaac
atggcaacctcgggtagcggtcagggttcaactacacgaatagatcatgaaacagccagt
gttttgagttctagtagcacacattctgctcctcgaaggctgacgagtcatctgggaacc
aaggtggaaatggtgtattcattgttgtcaatgcttggtactcatgataaggatgatatg
tcgcgaactttgctagctatgtctagctcccaagacagctgtatatccatgcgacagtct
ggatgtcttcctctcctcatccagcttttacatggcaatgacaaagactctgtgttgttg
ggaaattcccggggcagtaaagaggctcgggccagggccagtgcagcactccacaacatc
attcactcacagcctgatgacaagagaggcaggcgtgaaatccgagtccttcatcttttg
gaacagatacgagcttactgtgaaacctgttgggagtggcaggaagcccatgaacaaggc
atggaccaggacaaaaatccaatgccagctcctgttgaacatcagatctgccctgctgtc
tgtgttctaatgaagctttcgtttgatgaagagcatagacatgccatgaatgagcttggg
ggactacaggccattgcagaattattgcaagtggactgtgaaatgtatgggcttactaat
gaccactacagtattactttaagacgatatgcaggaatggctttgacaaacttgactttc
ggagatgtagccaacaaggctactctctgctctatgaaaggctgcatgagagcgctcgtg
gctcagctccagtctgaaagcgaggacttgcagcaggttattgcgagtgttttgaggaat
ctgtcttggagagcagatgtaaatagtaaaaagactttgcgtgaagttggaagtgtgaaa
gcattgatggaatgtgctttggaagtgaaaaaggaatcaaccctcaaaagtgtattgagt
gccttatggaacttgtcagcacactgcactgagaataaagctgacatatgtgctgtggat
ggtgcgcttgcatttttggttggcactctcacttatcgcagccagaccaatactttagcc
attattgaaagtggaggtgggatattacggaatgtatccagcttgatagctacaaatgag
gaccacaggcaaatcctaagagagaataattgcttacagaccttattacaacacttgaaa
tctcacagtttgacaatagtcagcaatgcatgcggaaccttgtggaatctctcagcaaga
aaccctaaagaccaggaagcattgtgggacatgggagcagtcagcatgctcaagaacctc
attcattcaaagcacaagatgattgctatgggaagtgctgcagctttaaggaatctcatg
gcaaatagacctgcaaagtataaagatgccaatatcatgtctcctggttcaagtttgcct
tctctacatgtcaggaaacaaaaggccctggaagcagaattagatgctcagcatttatca
gaaacttttgacaatattgacaatttaagtcccaaggcatctcatcgtagcaagcagaga
cacaagcaaaatctctatggtgactatgtttttgacaccaatcgacatgatgataacagg
tcagacaattttaatactggaaacatgactgtcctatcaccgtacttaaacactacagta
ttgcccagctcttcttcatcaaggggaagtttagatagctctcgttctgagaaagataga
agtctggagagagaacgaggtattagcctaggcaactatcacccagcaacagaaaaccca
ggaacctcttcaaagcgaggtttgcagatttctaccactgcagcccagattgccaaagtc
atggaagaagtatcagctattcatacctctcaggaagacagaagttctgggtctaccaca
gaactacactgtgggacagatgagaggaatgcactaagaagaagctctaccacccacaca
catgcaaacacgtacaactttaccaagtcagaaaactcaaacagaacatgtccaatacca
tatgccaaagtagaatataagagatcttcaaatgatagtttaaatagtgtcagcagtagt
gatggttatggtaaaagaggtcagatgaaaccttcaattgaatcctattctgaagatgat
gaaagtaaattttgcagctatggtcagtatccagctgacctagcccataaaatacatagt
gcaaatcatatggatgataatgatggagaactagatacaccaataaattacagtctcaaa
tattccgatgaacagttgaactctgggaggcagagcccttcacagaatgaaagatgggca
agacccaaacatatactagaagatgaaataaaaccgaatgagcagagacaatcaaggagt
caaagcacagcttatcccgtgtatcctgagagcactgatgataaacacctcaagttccaa
ccacactttgggcagcaagaatgtgtttcyccatacaggtcaagagcagccaatggatct
gaaacaaatcgagtaggctctaatcatggaattagtcaaaatgtgaaccagtctttgtgt
caagaagatgactatgaagacgataaaccaaccaactatagcgaacgttactctgaggaa
gggcagcatgaggaagaagagaggccaaccaattatagcataaaatacagtgaagaaaaa
catcacgtggatcagcctattgattatagtttaaaatacaccacagacattccttcttca
cagaaaccagcattttcattctcaaagaattcatctggacagagcacaaaaactgaacac
atctcttcaagcagcgagaatacatccacaacttcatctaatgccaagaggcagaatcag
ctgcatccaagctcagcacagagcagaagtggtcagaccccaaaagccacctcttcctct
tgyaaagtcccctctatcaaccaagaaacaatacagacttactgtgtagaagatacccca
atatgtttttcaagatgcagttcattatcatctctgtcatctgctgaagatgaagtaggg
tgtgatcagacaacacaagaagcagagtctgctaacactctgcaaatagctgaaatcaag
gacaacagcggacctaggtcaaatgaagattctgtgagtaaagttccagcagggtcacag
cacattagaaccaaatccagcagactccaggcttctggtctgtcttcagagtcagccagg
cacaaagctgttgaattttcttcaggggccaaatctccttccaagagcggtgctcagaca
cccaaaagtccaccagagcactacgttcaggagaccccactcatgtttagcagatgtact
tcagtcagttcactcgacagttttgagagtcgctcgattgccagctctgttcagagtgaa
ccctgcagtggaatggtaagtggcatcataagccccagtgacctcccagatagccctgga
caaaccatgccaccaagcagaagcaaaacccctccgctgcctcctccgcctcctcctcag
acagttcaaacgaagcaggaagtacctaaaaataaagcacctagtgctgaaaagagagaa
agtggacccaagcaagctgctgtaaatgctgcagtacaaagggtccaggttcttccagag
gctgatactctgttacattttgccacagagagtactcctgatggattttcttgttcatct
agcctgagcgctctgagccttgatgagccatttattcwgaaagatgtggaactaagaata
atgcctccagttcaggaaaatgacaacgggaatgaaacagaaagtgagcagcctgaagaa
tcaaatgaaaaccaggaaaaagaggcagaaaaacccactgattctgaaaaagatctttta
gatgagtcagatgatgatgatattgaaatactagaagagtgtataatttctgccatgcca
acaaaatcttcacgcaaagccaaaaaaccagcccagactacttcaaaattacctccacct
gtggcaaggaaaccaagtcagctccctgtatacaaacttctgccatcgcaaaacaggtta
caggcacaaaagcatgttagttttacaccaggagatgatatgccacgggtgtattgtgta
gaagggacacctataaacttttccacagctacatctctgagtgatctaacgatagaatcc
cctccaaatgagttagctgctggagaaggggttagagcaggggcacagtcaagtgarttt
gaaaaacgagataccattcctactgaaggcagaagtacagatgaggctcaacgagggaaa
gcctcatctgtcactgtgcctgagctggatgacagcaaaacagaagaaggtgatattctt
gcagaatgcattaattctgccatgcccaaaggaaaaagtcacaagcctttccgtgtgaaa
aagattatggaccaggtccagcaagcatctatgtcttcatctggaactaacaaaaatcaa
ttagatggtaagacgaagaaacctacttcaccagtaaaacctataccacaaaatactgaa
tacaggacacgtgtaagaaaaartacagactcaaaaaataatctaaatgcagaaagaaat
ttctcrgaaaacaaagactcaaagaaacagcacttgaaaaataattccaaggacttcaat
gataaactgccaaataatgaagacagagtcagaggaagttttacttttgattcaccccat
cattacacgcccattgaaggcactccrtactgtttttcacgaaatgactctttgagttcy
ctagattttgatgatgatgatgttgacctttccagggaaaaggctgaattaagaaagggg
aaggaaaataaagaatcagaagctaaagtgaccaaccacacagaactaacctcaaaccaa
caatcagctagtaagacaccagctgttacaaagcagccaayaaatagaggtcagtctaaa
cccgtgctgcagaagcagtccacttttccccagtcttccaaagatataccagacagaggg
gcagcaacagatgagaaattacagaatttcgctattgaaaatactccagtttgcttttct
cgaaattcctctctaagctctcttagtgacattgatcaagaaaacaacaacaacaaggaa
aatgaacctgtcaaagagacagagccccctgcctcacagggagaaccaggtaaaccccag
gcctcaggttatgctcctaaatcgtttcacgtggaagacacccctgtttgtttctcaaga
aacagttctctcagttctcttagtattgattctgaagatgacctgctgcaggaatgtata
agttctgcaatgccaaaaaagaaaaagccttcaaggctcaagcccgataatgaaaagcat
agtcccagaaatatgggtggcatattagcagaagatttgacactcgatttgaaagatata
cagagaccagattcagaacatggtttatccccagattcagaaaattttgattggaaagct
attcaggaaggtgcaaattccatagtaagtagtttacatcaagctgctgccgctgcatgt
ttatctcgacaagcttcatctgattcagattctatcctttcattgaaatcgggtatctct
ctgggatcaccatttcaccttacacctgatcaagaagaaaaaccctttacgagtaataaa
ggtccacgaattctaaaacctggggagaaaagtacattggaaactaaaaaaatagaatct
gaaaataaaggaataaaaggaggcaaaaaggtttataaaagtttgattactggaaaagtt
cgatctaattcggaaatttcgagccaaatgaaacaaccccttcaaacaaacatgccttca
atctctcgaggtaggacaatgattcatattccaggagttcggaatagctcttcaagtaca
agcccagtttctaaaaaaggcccgcccctcaagactccagcctccaaaagccctagtgaa
ggtcagccggctaccacctctcccagaggaaccaagccatcagtgaagtcagaattaagc
cctgttacaaggcaggcatcccagacagcaggatcaaacaaaggaccttctagatcagga
tctagagattccactccttcaagacctgcccagcaaccattaagtagaccaatgcagtct
ccagggcgaaactcaatctctcctggtagaaatggaataagtccccctaacaaattatct
caactaccaaggacgtcatcccctagtactgcttcmactaagtcctcaggttctgggaaa
atgtcttacacatctcctggcagacagatgagccagcagaacctcaccaaacaaacaggc
ttatccaagaatggcagtggtatcccaagaagtgaatctgcctccaaagggctaaatcaa
atgagtaatagtaatggatccaataaaaaagtagaactttctagaatgtcttcaacaaag
tcaagtggaagtgaatccgataggtcagagagacctgtattagtacgccaatcaactttc
atcaaagaagctccaagcccaaccctaaggagaaaactggaggaatctgcttcatttgaa
tctctttctccatcttccagacccgattctcccacacggtcccaggctcatactccagtt
ttaagtccttcccttcctgatatgtctctatctacacattcgtctgttcagtctggtgga
tggcgaaaactcccacctaacctcagtcccaccatagagtataatgatggaagaccagta
aagcgccatgatatagcacgctctcattccgaaagtccttccagacttcccatcaatagg
tcagggacctggaaacgtgagcacagcaaacactcatcatcacttcctcgagtaagcact
tggagaagaactggaagttcatcctcaattctttctgcttcatcagaatctagtgaaaag
gcaaaaagtgaggacgaaaaacaagtgaactctatttcaggaagcaaacaaactaaagaa
aaccaggtatccacaaaaggaacatggagaaaaataaaagaaagtgaaatttctcccaca
aatagtacttctcagaccacttcttcaggtgctgcaaatggtgctgaatcaaagactctg
atttatcaaatggcacctgctgtttctaaaacagaggatgtttgggtgagaattgaggat
tgccccattaacaaccctagatctggaagatctccaacaggaaatactccccccgtgatt
gacactgtttcagaaaagggaaacccraaccctaaagattcaaaagataatcagggaaaa
caaaatgtgagcaatggtagtgcccctacacgcaccatgggtctggaaaaccgcctgaat
tcctttattcaggtagatcctccagaccaaaaaggaactgagacaaaaccgggacacagt
aataaccctgtccctgcatccgagactagtgaaagttctatagccgagcgtaccccgttt
agttctagcagctcaagcaagcacagttcaccaagtgggactgtcgccgccagggtgagt
ccttttaattacaacccaagcccaaggaagagcagcacagatggcacttcagcccgaccg
tctcagatcccaacgccagtgagcaacaacacaaagaaacgcgactcaaaacccgacagc
acagaacccagcgggactcaaagtcctaaacgccattctgggtcttaccttgtgacatct
gtgtga

DBGET integrated database retrieval system