KEGG   Bos indicus (zebu cattle): 109562156
Entry
109562156         CDS       T04792                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04390  Hippo signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05200  Pathways in cancer
biu05218  Melanoma
biu05224  Breast cancer
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109562156 (FGF1)
   04014 Ras signaling pathway
    109562156 (FGF1)
   04015 Rap1 signaling pathway
    109562156 (FGF1)
   04390 Hippo signaling pathway
    109562156 (FGF1)
   04151 PI3K-Akt signaling pathway
    109562156 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109562156 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562156 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    109562156 (FGF1)
   05218 Melanoma
    109562156 (FGF1)
   05224 Breast cancer
    109562156 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562156 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109562156 (FGF1)
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109562156 (FGF1)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109562156 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 109562156
NCBI-ProteinID: XP_019820711
LinkDB
Position
7
AA seq 155 aa
MAEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQ
LCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
HWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaaccacgaccttcacggccctgactgagaagtttaacctgcctcta
ggcaattacaagaagcccaagctcctctaytgcagcaacgggggctacttcctgagaatc
ctcccagatggcacagtggatgggacgaaggacaggagcgaccagcacattcagctgcag
ctctgtgcggaaagcataggggaggtgtatattaagagtacggagactggccagttcttg
gccatggacaccgacgggcttttgtacggctcacagacacccaatgaggaatgtttgttc
ctggaaaggttggaggaaaaccattacaacacctacatatccaagaagcatgcagagaag
cattggttcgttggtctcaagaagaacggaaggtctaaactcggtcctcggactcacttc
ggccagaaagccatcttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system