KEGG   Bos indicus (zebu cattle): 109562194
Entry
109562194         CDS       T04792                                 

Gene name
CSF1R
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04151  PI3K-Akt signaling pathway
biu04380  Osteoclast differentiation
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109562194 (CSF1R)
   04014 Ras signaling pathway
    109562194 (CSF1R)
   04015 Rap1 signaling pathway
    109562194 (CSF1R)
   04151 PI3K-Akt signaling pathway
    109562194 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562194 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109562194 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109562194 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562194 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562194 (CSF1R)
   05202 Transcriptional misregulation in cancer
    109562194 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109562194 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109562194 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109562194 (CSF1R)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109562194 (CSF1R)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109562194 (CSF1R)
CD molecules [BR:biu04090]
 Proteins
  109562194 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 PKD_3 Ig_6
Other DBs
NCBI-GeneID: 109562194
NCBI-ProteinID: XP_019820788
UniProt: A0A6P5C5Q4
LinkDB
Position
7
AA seq 964 aa
MGPRTLLILLVVTAWHGQGVPVIEPSGPELVVEPGTAVTLRCTSNGSVKWDGPVSPYWTL
DSDAPRSILTTNNATFLHTGTYRCTEPGDPLAGTATIHLYVKDPARPWRVLAEEVTVLEG
QDALLPCLLTDPALEAGVSLVRVRGRSVLRQTSYSFSPWYGFTIHKAKFIESQDYECSVR
VAGRVVKSLSIRLKVQKVIPGPPTLTLEPEELVRIQGETAKIVCSASDVDVNFDVFLQRG
DTKLAISQQSDFRDNRYQKVLTLELDHVGFQDAGNYTCVATNARGVHTTSMVFRVVDSAY
LNLTSEQNLLQEVAVGEKLELRVKVEAYPSLQSFNWTYEGPFFGSQPKLNFETTNNTYRY
TSKLTLPRLKPSEAGLYSFQARNARGEDTLTFELTLLYPPEVEVMWTLSNGSKALLCEAS
GYPQPNVTWVQCSSHTNRCDKTHVLVLEEPNPDVLRQEPFHKVTVQSLLTPGTLEHNRTY
ECRAQNSMGNTSGALGPISVGASMQPRDEPLFTPVLVACMSIMALLLLLLLLLFYKYKQK
PKYEVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFG
LGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVIT
EYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEAGTGYKNIHLEKKYIRRDSGFSSQGVDTY
VEMRPVSTSSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAAR
NVLLTSGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYG
ILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPENIYSIMQACWALEPTRRPT
FQQICSLLQEQVQVDRREQDYSNLPSSGSSSSEPEEESSSEHLTCCEQGDIAQPLLQPNN
YQFC
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgggcccacggaccctgctgatcctgctggtggtcacagcttggcatggtcagggggtc
ccagtgatagagcccagtggccctgagctggtggtggagccaggcacagcggtgaccttg
cgatgtacgagcaatggcagcgtgaagtgggatggccccgtttccccctactggactctg
gactctgacgcccccagaagcatcctcaccacgaacaatgccaccttcctacacacggga
acgtaccgctgcactgagcctggagaccccctggcgggcactgctactatccacctctac
gtcaaagaccctgctcggccctggagggtcctggccgaggaagtgacggtgttggagggt
caggacgcgctgctgccctgtctgctcactgacccagcactggaggcgggcgtctcgctg
gtgcgggtgcgcggccggtctgtcttgcgccaaaccagctattccttctcgccctggtac
ggcttcaccatccacaaggccaagttcattgagagccaggactacgagtgcagcgttcgg
gtggctggcagggtggtgaagtccctcagcatccggcttaaagttcagaaagtcatccca
ggaccgccgaccttgacattggagcctgaagagctggtgcggattcaaggggagactgcc
aagatcgtgtgctcagccagtgacgttgatgtcaactttgacgtcttccttcaacgtgga
gacacaaaactcgcaatctctcaacaatccgacttccgtgacaaccgttatcaaaaagtc
ctgactctcgaactcgatcacgtaggcttccaagatgctggcaactacacctgtgtggcc
accaatgcccggggcgtccacactacctccatggtcttccgggtggtagacagtgcctac
ttgaacttaacctctgagcagaacctcctccaagaggtggccgtgggtgaaaagcttgaa
ctcagagtcaaggtggaggcctacccaagcctgcaaagtttcaactggacctatgagggt
cccttctttggttcccagcccaagctcaactttgaaaccacgaacaacacatacagatac
acctccaagctcaccctgcctcgcctgaagccctccgaggccggcctctactccttccag
gctagaaatgccagaggcgaggacaccctgacctttgaactcaccctcctataccccccg
gaagtagaagtcatgtggaccctctccaatggctctaaagccctgctctgtgaagcctcc
gggtacccccagcccaatgtgacgtgggtgcagtgcagcagccacaccaacagatgtgat
aagacccacgtgctggtcctggaggagccgaaccctgatgtcctgcgccaggagcccttc
cacaaagtgaccgtccagagcctgctgacccctgggaccttggaacacaacaggacgtac
gagtgcagggcccagaacagcatggggaacacctccggggctttggggcccatctccgta
ggagcctccatgcagccccgcgatgagcccctcttcacaccggtgctggtggcctgcatg
tccatcatggccttgctgctgctgctgctgctgctgctcttctacaagtacaagcagaag
cccaagtacgaggtgcgctggaagatcatcgagagctatgaaggcaacagctacaccttc
atcgaccccacccagctgccctacaatgagaagtgggagttcccccggaacaacctgcag
tttggtaagacccttggagccggcgccttcgggaaggtggtagaggccacggcttttggt
ctgggcaaggaagatgctgtcctgaaggtggctgtgaagatgctgaagtccacggcgcat
gctgacgagaaggaagccctcatgtcagagctgaagatcatgagccacctgggccagcac
gagaacatagtcaacctcttgggagcctgtacccacggaggccctgtcctggtcatcacg
gagtactgttgctatggtgacctgctcaactttctgcgaaggaaggctgaggccatgctg
ggacccagcctgagtccaggccaggatcccgaggcaggcaccggctacaagaacatccac
ttggaaaagaaatacatccgcagggacagcggcttctccagccagggtgtggacacctat
gtggagatgagacctgtgtccacttcgtcgtcaaatgactcattctctgaacaagacctg
gacaaggaggacgggcggccgctggagctgcgtgacctgctccacttctcgagccaggtg
gcccagggcatggcctttcttgcttccaagaattgcatccatcgggacgtggcggccaga
aacgtgctgctgaccagcggccacgtggccaagattggggactttggtctggctcgggac
atcatgaatgactccaactacatcgttaagggcaacgctcgcctgcccgtgaagtggatg
gcgccagagagcatcttcgactgcgtctacaccgttcagagcgacgtgtggtcctacggc
atcctgctctgggagatcttctcactcgggctcaacccctaccctggtatcctggtgaac
agcaagttctataagctggtgaaggatggataccaaatggctcagcccgcgtttgcccca
gagaacatatacagcatcatgcaggcctgctgggccctggagccgacgcgcagacccacc
ttccagcagatctgctccctcctccaggagcaggttcaggtggacaggagagagcaggac
tacagcaatctgccgagcagtggcagcagcagcagcgagccagaggaggagagctccagc
gaacacctgacctgctgtgagcagggcgacatcgcccagcccctgctgcaacccaacaac
taccagttctgctga

DBGET integrated database retrieval system