KEGG   Bos indicus (zebu cattle): 109562461
Entry
109562461         CDS       T04792                                 

Gene name
RPS6
Definition
(RefSeq) 40S ribosomal protein S6
  KO
K02991  small subunit ribosomal protein S6e
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu03010  Ribosome
biu04066  HIF-1 signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04371  Apelin signaling pathway
biu04714  Thermogenesis
biu04910  Insulin signaling pathway
biu05171  Coronavirus disease - COVID-19
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    109562461 (RPS6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109562461 (RPS6)
   04066 HIF-1 signaling pathway
    109562461 (RPS6)
   04151 PI3K-Akt signaling pathway
    109562461 (RPS6)
   04150 mTOR signaling pathway
    109562461 (RPS6)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109562461 (RPS6)
  09159 Environmental adaptation
   04714 Thermogenesis
    109562461 (RPS6)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109562461 (RPS6)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109562461 (RPS6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109562461 (RPS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:biu03011]
    109562461 (RPS6)
Ribosome [BR:biu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    109562461 (RPS6)
  Archaea
    109562461 (RPS6)
SSDB
Motif
Pfam: Ribosomal_S6e
Other DBs
NCBI-GeneID: 109562461
NCBI-ProteinID: XP_019821087
UniProt: A0A6P5C7G5
LinkDB
Position
8
AA seq 229 aa
VLSRLKGVLLRGHNALSLTCHRVLLQGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKG
HSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASR
IRKLFNLSKEDDVRQYVVRKPLNKDGKKPRTKAPKIQRLVTPRVLQHKRXRIALKKQRTK
KNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK
NT seq 690 nt   +upstreamnt  +downstreamnt
gtactaagtagacttaagggtgtacttctcagaggccacaatgctttgtctttaacttgt
catcgtgttctcctgcagggttatgtggtccgaatcagtggcgggaacgataagcagggt
ttccccatgaagcagggtgtcttgacccatggcagagttcgcctgctactgagtaagggg
cattcctgttacagaccaaggaggactggagagagaaagcgcaaatctgtacggggttgc
attgtggatgccaatctgagtgttctcaatttggtcatcgtgaaaaaaggggaaaaggat
attcctggactcactgatactacagtgcctcgtcgcctgggtcccaaaagagccagcaga
atccgcaagcttttcaatctctctaaagaagatgatgtccgccaatatgttgtgcgaaag
cccctaaacaaagacggtaagaaacctaggactaaagcacccaagattcagcgtctcgtg
actccacgagtcctgcagcacaaacgcnggcgtattgctctgaagaaacagcgtactaag
aaaaataaagaagaggctgcagaatatgctaaacttttggccaagagaatgaaggaggcc
aaagaaaaacggcaggaacagattgccaagagacggaggctgtcctctctgagagcttct
acttctaagtctgagtccagtcaaaaatga

KEGG   Bos indicus (zebu cattle): 109571278
Entry
109571278         CDS       T04792                                 

Definition
(RefSeq) 40S ribosomal protein S6
  KO
K02991  small subunit ribosomal protein S6e
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu03010  Ribosome
biu04066  HIF-1 signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04371  Apelin signaling pathway
biu04714  Thermogenesis
biu04910  Insulin signaling pathway
biu05171  Coronavirus disease - COVID-19
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    109571278
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109571278
   04066 HIF-1 signaling pathway
    109571278
   04151 PI3K-Akt signaling pathway
    109571278
   04150 mTOR signaling pathway
    109571278
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109571278
  09159 Environmental adaptation
   04714 Thermogenesis
    109571278
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109571278
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109571278
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109571278
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:biu03011]
    109571278
Ribosome [BR:biu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    109571278
  Archaea
    109571278
SSDB
Motif
Pfam: Ribosomal_S6e
Other DBs
NCBI-GeneID: 109571278
NCBI-ProteinID: XP_019833198
UniProt: A0A6P5D525
LinkDB
Position
2
AA seq 264 aa
MALFRGASEAVGRFRMKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEW
KGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDAN
LSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKD
GKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKDEAAEYAKLLAKRMKEAKEKRQ
EQIAKRRRLSSLRASTSKTESSQK
NT seq 795 nt   +upstreamnt  +downstreamnt
atggctctttttcgtggcgcctcggaggctgtcggccgcttcagaatgaagctgaacatc
tctttcccggccactggctgccagaagctcattgaagtggacgatgaacgaaaacttcgt
accttctatgagaagcgtatggccacagaagttgctgccgacgctctgggtgaagaatgg
aagggttatgtggtccgaatcagtggcgggaacgataagcagggtttccccatgaagcag
ggtgtcttgacccatggcagagttcgcctgctactgagtaaggggcattcctgttacaga
ccaaggaggactggagagagaaagcgcaaatctgtacggggttgcattgtggatgccaat
ctgagtgttctcaatttggtcatcgtgaaaaaaggggaaaaggatattcctggactcact
gatactacagtgcctcgtcgcctgggtcccaaaagagccagcagaatccgcaaacttttc
aatctctctaaagaagatgatgtccgccaatatgttgtgcgaaagcccctaaacaaagac
ggtaagaaacctaggactaaagcacccaagattcagcgtctcgtgactccacgagttctg
caacacaaacgccggcgtattgctctgaagaaacagcgtactaagaaaaataaagacgag
gctgcagagtatgctaaacttttggccaagagaatgaaggaggccaaagaaaaacggcag
gaacagattgccaagagacggaggctgtcctctctgagagcttctacttctaagactgag
tccagtcaaaaatga

DBGET integrated database retrieval system