KEGG   Bos indicus (zebu cattle): 109562627
Entry
109562627         CDS       T04792                                 

Definition
(RefSeq) tumor suppressor ARF-like isoform X1
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04218  Cellular senescence
biu04934  Cushing syndrome
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05212  Pancreatic cancer
biu05214  Glioma
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05223  Non-small cell lung cancer
biu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109562627
   04115 p53 signaling pathway
    109562627
   04218 Cellular senescence
    109562627
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562627
   05206 MicroRNAs in cancer
    109562627
   05203 Viral carcinogenesis
    109562627
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109562627
   05225 Hepatocellular carcinoma
    109562627
   05214 Glioma
    109562627
   05220 Chronic myeloid leukemia
    109562627
   05218 Melanoma
    109562627
   05219 Bladder cancer
    109562627
   05223 Non-small cell lung cancer
    109562627
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109562627
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109562627
   05163 Human cytomegalovirus infection
    109562627
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109562627
   01522 Endocrine resistance
    109562627
SSDB
Motif
Pfam: P19Arf_N
Other DBs
NCBI-GeneID: 109562627
NCBI-ProteinID: XP_019821213
UniProt: A0A6P5C6W5
LinkDB
Position
8
AA seq 153 aa
MVRRFLITVRIRRANGPPRVRIFVVHIARAAGEWAAPSVRAAVALVLMASEEPAQSAAMH
PRPGDDDGQRPRGRAAAAPRRGPQLRGPRHPHPTGARRRPGGLPGHAGGPAPSWSAAGCA
RCLGPPARGPGGGAGPPRRRPVPARGCRGHGRR
NT seq 462 nt   +upstreamnt  +downstreamnt
atggtgcgccggttcttgattacagtgaggattcggcgcgcgaacggcccaccacgagtc
aggattttcgtggtgcacatcgcgcgggcagcgggtgagtgggcagcgccgagtgtgcgg
gccgctgtggccctcgtgctgatggctagtgaggagccagcgcagagcgcagcgatgcat
cctagaccaggtgatgatgatgggcagcgcccgcgtggccgagctgctgctgctccacgg
cgcggaccccaactgcgcggaccccgccaccctcacccgaccggtgcacgacgccgcccg
ggagggcttcctggacacgctggtggccctgcaccgagctggagcgcggctggatgtgcg
cgatgcttggggccgcctgcccgtggacctggcggaggagcggggccaccgcgacgtcgc
ccggtacctgcgcgcggctgcagaggacacggaaggcggtag

DBGET integrated database retrieval system