KEGG   Bos indicus (zebu cattle): 109562638
Entry
109562638         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-G-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562638
   04151 PI3K-Akt signaling pathway
    109562638
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562638
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562638
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562638
   04621 NOD-like receptor signaling pathway
    109562638
   04622 RIG-I-like receptor signaling pathway
    109562638
   04623 Cytosolic DNA-sensing pathway
    109562638
   04650 Natural killer cell mediated cytotoxicity
    109562638
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562638
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562638
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562638
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562638
   05161 Hepatitis B
    109562638
   05160 Hepatitis C
    109562638
   05171 Coronavirus disease - COVID-19
    109562638
   05164 Influenza A
    109562638
   05162 Measles
    109562638
   05168 Herpes simplex virus 1 infection
    109562638
   05163 Human cytomegalovirus infection
    109562638
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562638
   05169 Epstein-Barr virus infection
    109562638
   05165 Human papillomavirus infection
    109562638
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562638
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562638
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562638
NCBI-ProteinID: XP_019821226
UniProt: A0A6P5C6H6
LinkDB
Position
8
AA seq 189 aa
MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAITWDESLLDKLRTALDQQLTDLQ
FCLRQEXGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaacgccatctgc
tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgcaacaactgaggagggtctccccttcttcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagarggctcggccatcacgtgg
gacgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa
ttctgtctgaggcaggaggmggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatatttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562641
Entry
109562641         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562641
   04151 PI3K-Akt signaling pathway
    109562641
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562641
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562641
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562641
   04621 NOD-like receptor signaling pathway
    109562641
   04622 RIG-I-like receptor signaling pathway
    109562641
   04623 Cytosolic DNA-sensing pathway
    109562641
   04650 Natural killer cell mediated cytotoxicity
    109562641
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562641
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562641
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562641
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562641
   05161 Hepatitis B
    109562641
   05160 Hepatitis C
    109562641
   05171 Coronavirus disease - COVID-19
    109562641
   05164 Influenza A
    109562641
   05162 Measles
    109562641
   05168 Herpes simplex virus 1 infection
    109562641
   05163 Human cytomegalovirus infection
    109562641
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562641
   05169 Epstein-Barr virus infection
    109562641
   05165 Human papillomavirus infection
    109562641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562641
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562641
SSDB
Motif
Pfam: Interferon DUF2615
Other DBs
NCBI-GeneID: 109562641
NCBI-ProteinID: XP_019821228
UniProt: A0A6P5C6X9
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSLGCHLPHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTXGSAAAWDESLLDKLRTALDQQLTDLQ
ACLRQEEGLPGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccctcctcctggctctactgctgctcagctgcaacgccatctgc
tctctgggctgccacctgcctcactcccacagcctggccaagaggagagtcctgacactc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtactc
cacgaggtgacccaacacaccttccagcttttcagcacatagggctcggccgctgcgtgg
gatgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgccaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562644
Entry
109562644         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-F
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562644
   04151 PI3K-Akt signaling pathway
    109562644
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562644
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562644
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562644
   04621 NOD-like receptor signaling pathway
    109562644
   04622 RIG-I-like receptor signaling pathway
    109562644
   04623 Cytosolic DNA-sensing pathway
    109562644
   04650 Natural killer cell mediated cytotoxicity
    109562644
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562644
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562644
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562644
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562644
   05161 Hepatitis B
    109562644
   05160 Hepatitis C
    109562644
   05171 Coronavirus disease - COVID-19
    109562644
   05164 Influenza A
    109562644
   05162 Measles
    109562644
   05168 Herpes simplex virus 1 infection
    109562644
   05163 Human cytomegalovirus infection
    109562644
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562644
   05169 Epstein-Barr virus infection
    109562644
   05165 Human papillomavirus infection
    109562644
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562644
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562644
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562644
NCBI-ProteinID: XP_019821232
UniProt: A0A6P5C805
LinkDB
Position
8
AA seq 228 aa
METMGSYLRHRPEGRSSENKESRFTESPTSPGEASARSPMAPAWSLLLALLLLSCNAICS
LGCHLPHIHSLANRRVLMLLQQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLH
EVTQHTSQLFSTEGLAAVWDESLLDKLRAALDQQLTDLQACLRQEEGLRGAPLLKKDSSL
AVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD
NT seq 687 nt   +upstreamnt  +downstreamnt
atggaaaccatgggctcctacttaagacacaggcctgaaggaaggtcttcagaraacaaa
gagagcaggttcacagagtcacccacctccccaggagaagcatctgcaaggtccccgatg
gccccagcctggtccttacttctggccctgctgctgctcagctgcaacgccatctgctct
ctgggttgccacctgcctcacatccacagcctggccaacaggagggtcctgatgctcctg
caacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgactttgcattc
ccccaggaggctctgggtggcagccagttgcagaaggctcaagccatctctgtgctccac
gaggtgacccagcacacctcccagctcttcagcacagagggcttggccgctgtgtgggat
gagagcctcctggacaagcttcgcgctgcactggatcagcagcttactgacctgcaagcc
tgtctgaggcaggaggaggggctgcgaggggcccccctgctcaagaaggactccagccta
gctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagccct
tgtgcctgggaagttgtcagagcagaagtcatgagagccttctcttcctcaacaaacttg
caggagagtttcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562652
Entry
109562652         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-A
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562652
   04151 PI3K-Akt signaling pathway
    109562652
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562652
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562652
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562652
   04621 NOD-like receptor signaling pathway
    109562652
   04622 RIG-I-like receptor signaling pathway
    109562652
   04623 Cytosolic DNA-sensing pathway
    109562652
   04650 Natural killer cell mediated cytotoxicity
    109562652
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562652
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562652
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562652
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562652
   05161 Hepatitis B
    109562652
   05160 Hepatitis C
    109562652
   05171 Coronavirus disease - COVID-19
    109562652
   05164 Influenza A
    109562652
   05162 Measles
    109562652
   05168 Herpes simplex virus 1 infection
    109562652
   05163 Human cytomegalovirus infection
    109562652
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562652
   05169 Epstein-Barr virus infection
    109562652
   05165 Human papillomavirus infection
    109562652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562652
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562652
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562652
NCBI-ProteinID: XP_019821237
UniProt: A0A6P5C809
LinkDB
Position
8
AA seq 189 aa
MAPAWSFLLSLLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFE
FLQEALGGSQLQXXXEISVLHKVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQ
ACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctgctatccctgttgctgctcagctgcaacgccatctgc
tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgagacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgaa
ttcctccaggaggctctgggtggcagccagttacaannnnnnnnngaaatctctgtgctc
cataaggtgacccagcacaccttccagctcttcagcacagagggctcgcccgccacatgg
gacaagagcctcctggacaagctacgcgctgcgctggatcagcagctcactgacctgcaa
gcctgtctgacgcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562656
Entry
109562656         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562656
   04151 PI3K-Akt signaling pathway
    109562656
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562656
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562656
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562656
   04621 NOD-like receptor signaling pathway
    109562656
   04622 RIG-I-like receptor signaling pathway
    109562656
   04623 Cytosolic DNA-sensing pathway
    109562656
   04650 Natural killer cell mediated cytotoxicity
    109562656
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562656
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562656
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562656
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562656
   05161 Hepatitis B
    109562656
   05160 Hepatitis C
    109562656
   05171 Coronavirus disease - COVID-19
    109562656
   05164 Influenza A
    109562656
   05162 Measles
    109562656
   05168 Herpes simplex virus 1 infection
    109562656
   05163 Human cytomegalovirus infection
    109562656
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562656
   05169 Epstein-Barr virus infection
    109562656
   05165 Human papillomavirus infection
    109562656
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562656
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562656
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562656
NCBI-ProteinID: XP_019821243
UniProt: A0A6P5C6Z2
LinkDB
Position
8
AA seq 189 aa
MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFA
FPQEALHGSQLQKAQAISVLHEVTQHTFQLFSTEGSDATWDESLLDKLRTALDQQLTDLQ
ACLRQEEGLRGAPLLNEDSSLAVRKYFHRLTLYLQEKRHRPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaatgccatctgc
tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgcatggcagccagttgcagaaggctcaggccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctctgatgccacgtgg
gacgagagcctcctggacaagctccgcactgcactagatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaacgaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacaga
ccttgtgcctgggaggttgttagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562659
Entry
109562659         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562659
   04151 PI3K-Akt signaling pathway
    109562659
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562659
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562659
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562659
   04621 NOD-like receptor signaling pathway
    109562659
   04622 RIG-I-like receptor signaling pathway
    109562659
   04623 Cytosolic DNA-sensing pathway
    109562659
   04650 Natural killer cell mediated cytotoxicity
    109562659
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562659
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562659
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562659
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562659
   05161 Hepatitis B
    109562659
   05160 Hepatitis C
    109562659
   05171 Coronavirus disease - COVID-19
    109562659
   05164 Influenza A
    109562659
   05162 Measles
    109562659
   05168 Herpes simplex virus 1 infection
    109562659
   05163 Human cytomegalovirus infection
    109562659
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562659
   05169 Epstein-Barr virus infection
    109562659
   05165 Human papillomavirus infection
    109562659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562659
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562659
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562659
NCBI-ProteinID: XP_019821246
UniProt: A0A6P5C6J7
LinkDB
Position
8
AA seq 198 aa
MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLTLLRQXRRVSPSSCLQDRNDFA
FPQEALHGSQLQKAQAISVLHEVTQHTFQLFSTEGSATTWDESLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDASLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTN
LQERFRRKDRHTPGSTQK
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaatgccatctgc
tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgacgctc
ctgcgacaamtgagaagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgcatggcagccagttgcagaaggctcaggccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccaccacgtgg
gacgagagcctcctggacaagctccgagctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggatgccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcttcctcaaccaac
ttgcaggagagattcaggagaaaggacagacacacacctggttcaacacagaaatga

KEGG   Bos indicus (zebu cattle): 109562660
Entry
109562660         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562660
   04151 PI3K-Akt signaling pathway
    109562660
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562660
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562660
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562660
   04621 NOD-like receptor signaling pathway
    109562660
   04622 RIG-I-like receptor signaling pathway
    109562660
   04623 Cytosolic DNA-sensing pathway
    109562660
   04650 Natural killer cell mediated cytotoxicity
    109562660
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562660
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562660
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562660
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562660
   05161 Hepatitis B
    109562660
   05160 Hepatitis C
    109562660
   05171 Coronavirus disease - COVID-19
    109562660
   05164 Influenza A
    109562660
   05162 Measles
    109562660
   05168 Herpes simplex virus 1 infection
    109562660
   05163 Human cytomegalovirus infection
    109562660
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562660
   05169 Epstein-Barr virus infection
    109562660
   05165 Human papillomavirus infection
    109562660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562660
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562660
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562660
NCBI-ProteinID: XP_019821247
UniProt: A0A6P5C817
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCIAICSLGCHLPHTHSLPNRRVLTLLRQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAVWDQSLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDASLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN
LQEKFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccctcctcctggccctgctgctgctcagctgcatcgccatctgc
tctttgggttgccacctgcctcacacccacagcctgcccaacaggagggtcctgacactc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgactttgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgctgtgtgg
gaccagagcctcctggacaagctccgagctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggatgccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcttcaacaaac
ttgcaggagaaattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562665
Entry
109562665         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-B-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562665
   04151 PI3K-Akt signaling pathway
    109562665
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562665
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562665
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562665
   04621 NOD-like receptor signaling pathway
    109562665
   04622 RIG-I-like receptor signaling pathway
    109562665
   04623 Cytosolic DNA-sensing pathway
    109562665
   04650 Natural killer cell mediated cytotoxicity
    109562665
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562665
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562665
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562665
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562665
   05161 Hepatitis B
    109562665
   05160 Hepatitis C
    109562665
   05171 Coronavirus disease - COVID-19
    109562665
   05164 Influenza A
    109562665
   05162 Measles
    109562665
   05168 Herpes simplex virus 1 infection
    109562665
   05163 Human cytomegalovirus infection
    109562665
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562665
   05169 Epstein-Barr virus infection
    109562665
   05165 Human papillomavirus infection
    109562665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562665
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562665
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562665
NCBI-ProteinID: XP_019821252
UniProt: A0A6P5C821
LinkDB
Position
8
AA seq 189 aa
MAPAWSFLLSLLLLSCNAICSLGCHLPHSYSLPNRRVLMLLRQLRRVSPSSCLQDRNDFA
FPQEALGSSQLQKAQAISVLHEVTQHTFQLFSTEGSAATWDESLLDKLHAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRJTLYLREKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctgtccctgctgctgctcagctgcaatgccatctgc
tctctgggctgccacctgcctcactcctacagcctgcccaacaggagggtcctgatgctc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccacaggaggcgctgggtagcagccagttgcaaaaggctcaagccatctctgtgctc
cacgaggtgacccagcacacsttccagctcttcagcacagagggctcggctgccacgtgg
gacgagagcctcctggacaagctccacgctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggattccagc
ctggctgtgaggaaatacttccacagamtcactctctatctgcgagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos indicus (zebu cattle): 109562668
Entry
109562668         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562668
   04151 PI3K-Akt signaling pathway
    109562668
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562668
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562668
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562668
   04621 NOD-like receptor signaling pathway
    109562668
   04622 RIG-I-like receptor signaling pathway
    109562668
   04623 Cytosolic DNA-sensing pathway
    109562668
   04650 Natural killer cell mediated cytotoxicity
    109562668
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562668
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562668
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562668
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562668
   05161 Hepatitis B
    109562668
   05160 Hepatitis C
    109562668
   05171 Coronavirus disease - COVID-19
    109562668
   05164 Influenza A
    109562668
   05162 Measles
    109562668
   05168 Herpes simplex virus 1 infection
    109562668
   05163 Human cytomegalovirus infection
    109562668
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562668
   05169 Epstein-Barr virus infection
    109562668
   05165 Human papillomavirus infection
    109562668
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562668
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562668
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562668
NCBI-ProteinID: XP_019821255
UniProt: A0A6P5C6P5
LinkDB
Position
8
AA seq 186 aa
MTLPVSVLLALVMLCSSPMCSLGCELPASHHSNLESFTXWSQMERLPVVSCLRDRTDFRF
PQTLVXGTRLEKTEAIAVVHELLQQTFQLFSTTGSSAGRDESLLDRFLVGLDQQLEDLDT
CLREGRTPEQSPLGSENSRLAVKSYFQRISVYLKEKEYSRCAWEVLSVEIRRCLVFASKL
IGKLRK
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccctccctgtctctgtgctgctggccctggtgatgctctgctccagccccatgtgc
tccctgggctgtgagctgcctgcgagccaccacagcaatctggaaagcttcacacrttgg
agtcagatggagagactgcccgttgtgtcctgtctgagggacaggactgacttcagattt
cctcagaccctggtgcakgggaccaggcttgagaagacagaagccatagctgttgtacat
gagttgctccagcagaccttccagctcttcagcaccacaggctcttctgcaggtcgggac
gagagcctcctggacagattcctcgtgggacttgatcagcagctggaagacttggacacg
tgtctgagagagggaaggacaccrgaacagtcacctctagggagtgagaactccagattg
gctgtgaagagttacttccagcgaatcagtgtgtatctcaaagagaaagaatacagccgc
tgtgcctgggaggttctcagcgtggaaatcagaaggtgyttggtctttgccagcaagctc
atcggaaaactcaggaaataa

KEGG   Bos indicus (zebu cattle): 109562670
Entry
109562670         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562670
   04151 PI3K-Akt signaling pathway
    109562670
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562670
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562670
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562670
   04621 NOD-like receptor signaling pathway
    109562670
   04622 RIG-I-like receptor signaling pathway
    109562670
   04623 Cytosolic DNA-sensing pathway
    109562670
   04650 Natural killer cell mediated cytotoxicity
    109562670
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562670
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562670
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562670
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562670
   05161 Hepatitis B
    109562670
   05160 Hepatitis C
    109562670
   05171 Coronavirus disease - COVID-19
    109562670
   05164 Influenza A
    109562670
   05162 Measles
    109562670
   05168 Herpes simplex virus 1 infection
    109562670
   05163 Human cytomegalovirus infection
    109562670
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562670
   05169 Epstein-Barr virus infection
    109562670
   05165 Human papillomavirus infection
    109562670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562670
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562670
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562670
NCBI-ProteinID: XP_019821256
UniProt: A0A6P5C6K7
LinkDB
Position
8
AA seq 185 aa
MALLVXVLLALVMLCSSPTCSLGCELPSSHGNLESFTRWSQMERXPIVSCLRDRTDFRFP
QTLVHGTRLEETEATAVVHELLQQTFQLFSTTGSSAGRDKSLLDRFLVGLDQQLEDLDTC
LREGRTXEQSPLGSENSRLAVKSYFQRISVYLKEKEYSHCAWEVVSVEIRRCLVFANELI
GKLRK
NT seq 558 nt   +upstreamnt  +downstreamnt
atggccctcctcgtcwctgtgctgctggccctggtgatgctctgctccagccccacgtgc
tccctgggctgtgagctgccttcgagccacggcaatctggaaagcttcacacgttggagt
cagatggagagastgcccattgtgtcctgtctgagggacaggactgacttcagatttcct
cagaccctggtgcatgggaccaggcttgaggagacagaagccacagctgttgtgcacgag
ttgctccagcagaccttccagctcttcagcaccacrggctcttctgcaggtcgggacaag
agcctcctggacagattcctcgtgggacttgatcagcagttggaggacctggacacgtgt
ctgagggagggaaggacacyggaacagtcacctctagggagtgagaactccagattggct
gtgaagagttacttccagcgaatcagtgtgtatctcaaagagaaagaatacagccactgt
gcctgggaggttgtcagtgtggaaatcagaaggtgcttggtctttgccaatgagctcatt
ggaaaactcaggaaataa

KEGG   Bos indicus (zebu cattle): 109562673
Entry
109562673         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-3-like
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562673
   04151 PI3K-Akt signaling pathway
    109562673
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562673
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562673
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562673
   04621 NOD-like receptor signaling pathway
    109562673
   04622 RIG-I-like receptor signaling pathway
    109562673
   04623 Cytosolic DNA-sensing pathway
    109562673
   04650 Natural killer cell mediated cytotoxicity
    109562673
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562673
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562673
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562673
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562673
   05161 Hepatitis B
    109562673
   05160 Hepatitis C
    109562673
   05171 Coronavirus disease - COVID-19
    109562673
   05164 Influenza A
    109562673
   05162 Measles
    109562673
   05168 Herpes simplex virus 1 infection
    109562673
   05163 Human cytomegalovirus infection
    109562673
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562673
   05169 Epstein-Barr virus infection
    109562673
   05165 Human papillomavirus infection
    109562673
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562673
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562673
SSDB
Motif
Pfam: Interferon Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 109562673
NCBI-ProteinID: XP_019821258
UniProt: A0A6P5C708
LinkDB
Position
8
AA seq 157 aa
MQSCEPPASQWPSPSLCCWPLVMLCSSPTCSLGCELPSSHHGNLESFTCWSQMERLPIVS
CLRDRTDFRFPQTLVHGTRLEKTEATAAVHELLQQTFQLFSTTGSSAXRDESLLDRFLVG
LDQKLEDLDTCLREGRTREQSPLGXENSRXAVKXYFQ
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcagtcctgcgagcccccagcgtcccartggccctccccgtcactgtgctgctggccc
ttggtgatgctctgctccagccccacgtgctccctgggctgtgagctgccttcgagccac
cacggcaatctggaaagcttcacatgttggagtcagatggagagactgcccattgtgtcc
tgtctgagggacaggactgacttcagatttcctcagaccctggtgcacgggaccaggctt
gagaagacagaagccacagctgctgtgcacgagttgctccagcagaccttccagctcttc
agcaccacgggctcttctgcagrtcgggacgagagcctcctggacagattcctcgtggga
cttgatcagaagttggaggacctggacacgtgtctgagggagggaaggacacgggaacaa
tcacctctagggartgagaactccagatwggctgtgaagcrttacttccagtga

KEGG   Bos indicus (zebu cattle): 109562847
Entry
109562847         CDS       T04792                                 

Definition
(RefSeq) interferon alpha-H
  KO
K05414  interferon alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562847
   04151 PI3K-Akt signaling pathway
    109562847
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562847
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562847
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562847
   04621 NOD-like receptor signaling pathway
    109562847
   04622 RIG-I-like receptor signaling pathway
    109562847
   04623 Cytosolic DNA-sensing pathway
    109562847
   04650 Natural killer cell mediated cytotoxicity
    109562847
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562847
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109562847
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109562847
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562847
   05161 Hepatitis B
    109562847
   05160 Hepatitis C
    109562847
   05171 Coronavirus disease - COVID-19
    109562847
   05164 Influenza A
    109562847
   05162 Measles
    109562847
   05168 Herpes simplex virus 1 infection
    109562847
   05163 Human cytomegalovirus infection
    109562847
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562847
   05169 Epstein-Barr virus infection
    109562847
   05165 Human papillomavirus infection
    109562847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562847
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562847
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562847
NCBI-ProteinID: XP_019821438
UniProt: A0A6P5C7M6
LinkDB
Position
8
AA seq 189 aa
MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSXEGSAAVWDESLLDKLRAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLREKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc
tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcrcagagggctcagccgccgtgtgg
gatgagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctkcgagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcttcaacaaac
ttgcaggagagattcaggagaaaggactga

DBGET integrated database retrieval system