Bos indicus (zebu cattle): 109562638 Help Entry 109562638         CDS       T04792                                  Definition (RefSeq) interferon alpha-G-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562638    04151 PI3K-Akt signaling pathway     109562638   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562638  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562638  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562638    04621 NOD-like receptor signaling pathway     109562638    04622 RIG-I-like receptor signaling pathway     109562638    04623 Cytosolic DNA-sensing pathway     109562638    04650 Natural killer cell mediated cytotoxicity     109562638  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562638   09163 Immune disease    05320 Autoimmune thyroid disease     109562638   09171 Infectious disease: bacterial    05152 Tuberculosis     109562638   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562638    05161 Hepatitis B     109562638    05160 Hepatitis C     109562638    05171 Coronavirus disease - COVID-19     109562638    05164 Influenza A     109562638    05162 Measles     109562638    05168 Herpes simplex virus 1 infection     109562638    05163 Human cytomegalovirus infection     109562638    05167 Kaposi sarcoma-associated herpesvirus infection     109562638    05169 Epstein-Barr virus infection     109562638    05165 Human papillomavirus infection     109562638  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562638 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562638 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562638 NCBI-ProteinID:  XP_019821226 UniProt:  A0A6P5C6H6 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAITWDESLLDKLRTALDQQLTDLQ FCLRQEXGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaacgccatctgc tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcttcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagarggctcggccatcacgtgg gacgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa ttctgtctgaggcaggaggmggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatatttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

Bos indicus (zebu cattle): 109562641 Help Entry 109562641         CDS       T04792                                  Definition (RefSeq) LOW QUALITY PROTEIN: interferon alpha-1-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562641    04151 PI3K-Akt signaling pathway     109562641   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562641  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562641  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562641    04621 NOD-like receptor signaling pathway     109562641    04622 RIG-I-like receptor signaling pathway     109562641    04623 Cytosolic DNA-sensing pathway     109562641    04650 Natural killer cell mediated cytotoxicity     109562641  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562641   09163 Immune disease    05320 Autoimmune thyroid disease     109562641   09171 Infectious disease: bacterial    05152 Tuberculosis     109562641   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562641    05161 Hepatitis B     109562641    05160 Hepatitis C     109562641    05171 Coronavirus disease - COVID-19     109562641    05164 Influenza A     109562641    05162 Measles     109562641    05168 Herpes simplex virus 1 infection     109562641    05163 Human cytomegalovirus infection     109562641    05167 Kaposi sarcoma-associated herpesvirus infection     109562641    05169 Epstein-Barr virus infection     109562641    05165 Human papillomavirus infection     109562641  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562641 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562641 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF2615 Motif Other DBs NCBI-GeneID:  109562641 NCBI-ProteinID:  XP_019821228 UniProt:  A0A6P5C6X9 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHLPHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTXGSAAAWDESLLDKLRTALDQQLTDLQ ACLRQEEGLPGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccctcctcctggctctactgctgctcagctgcaacgccatctgc tctctgggctgccacctgcctcactcccacagcctggccaagaggagagtcctgacactc ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtactc cacgaggtgacccaacacaccttccagcttttcagcacatagggctcggccgctgcgtgg gatgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgccaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

Bos indicus (zebu cattle): 109562644 Help Entry 109562644         CDS       T04792                                  Definition (RefSeq) interferon alpha-F   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562644    04151 PI3K-Akt signaling pathway     109562644   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562644  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562644  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562644    04621 NOD-like receptor signaling pathway     109562644    04622 RIG-I-like receptor signaling pathway     109562644    04623 Cytosolic DNA-sensing pathway     109562644    04650 Natural killer cell mediated cytotoxicity     109562644  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562644   09163 Immune disease    05320 Autoimmune thyroid disease     109562644   09171 Infectious disease: bacterial    05152 Tuberculosis     109562644   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562644    05161 Hepatitis B     109562644    05160 Hepatitis C     109562644    05171 Coronavirus disease - COVID-19     109562644    05164 Influenza A     109562644    05162 Measles     109562644    05168 Herpes simplex virus 1 infection     109562644    05163 Human cytomegalovirus infection     109562644    05167 Kaposi sarcoma-associated herpesvirus infection     109562644    05169 Epstein-Barr virus infection     109562644    05165 Human papillomavirus infection     109562644  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562644 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562644 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562644 NCBI-ProteinID:  XP_019821232 UniProt:  A0A6P5C805 LinkDB All DBs Position 8 AA seq 228 aa AA seqDB search METMGSYLRHRPEGRSSENKESRFTESPTSPGEASARSPMAPAWSLLLALLLLSCNAICS LGCHLPHIHSLANRRVLMLLQQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLH EVTQHTSQLFSTEGLAAVWDESLLDKLRAALDQQLTDLQACLRQEEGLRGAPLLKKDSSL AVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD NT seq 687 nt NT seq  +upstreamnt  +downstreamnt atggaaaccatgggctcctacttaagacacaggcctgaaggaaggtcttcagaraacaaa gagagcaggttcacagagtcacccacctccccaggagaagcatctgcaaggtccccgatg gccccagcctggtccttacttctggccctgctgctgctcagctgcaacgccatctgctct ctgggttgccacctgcctcacatccacagcctggccaacaggagggtcctgatgctcctg caacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgactttgcattc ccccaggaggctctgggtggcagccagttgcagaaggctcaagccatctctgtgctccac gaggtgacccagcacacctcccagctcttcagcacagagggcttggccgctgtgtgggat gagagcctcctggacaagcttcgcgctgcactggatcagcagcttactgacctgcaagcc tgtctgaggcaggaggaggggctgcgaggggcccccctgctcaagaaggactccagccta gctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagccct tgtgcctgggaagttgtcagagcagaagtcatgagagccttctcttcctcaacaaacttg caggagagtttcaggagaaaggactga

Bos indicus (zebu cattle): 109562652 Help Entry 109562652         CDS       T04792                                  Definition (RefSeq) interferon alpha-A   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562652    04151 PI3K-Akt signaling pathway     109562652   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562652  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562652  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562652    04621 NOD-like receptor signaling pathway     109562652    04622 RIG-I-like receptor signaling pathway     109562652    04623 Cytosolic DNA-sensing pathway     109562652    04650 Natural killer cell mediated cytotoxicity     109562652  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562652   09163 Immune disease    05320 Autoimmune thyroid disease     109562652   09171 Infectious disease: bacterial    05152 Tuberculosis     109562652   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562652    05161 Hepatitis B     109562652    05160 Hepatitis C     109562652    05171 Coronavirus disease - COVID-19     109562652    05164 Influenza A     109562652    05162 Measles     109562652    05168 Herpes simplex virus 1 infection     109562652    05163 Human cytomegalovirus infection     109562652    05167 Kaposi sarcoma-associated herpesvirus infection     109562652    05169 Epstein-Barr virus infection     109562652    05165 Human papillomavirus infection     109562652  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562652 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562652 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562652 NCBI-ProteinID:  XP_019821237 UniProt:  A0A6P5C809 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSFLLSLLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFE FLQEALGGSQLQXXXEISVLHKVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQ ACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctgctatccctgttgctgctcagctgcaacgccatctgc tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgagacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgaa ttcctccaggaggctctgggtggcagccagttacaannnnnnnnngaaatctctgtgctc cataaggtgacccagcacaccttccagctcttcagcacagagggctcgcccgccacatgg gacaagagcctcctggacaagctacgcgctgcgctggatcagcagctcactgacctgcaa gcctgtctgacgcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

Bos indicus (zebu cattle): 109562656 Help Entry 109562656         CDS       T04792                                  Definition (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562656    04151 PI3K-Akt signaling pathway     109562656   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562656  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562656  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562656    04621 NOD-like receptor signaling pathway     109562656    04622 RIG-I-like receptor signaling pathway     109562656    04623 Cytosolic DNA-sensing pathway     109562656    04650 Natural killer cell mediated cytotoxicity     109562656  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562656   09163 Immune disease    05320 Autoimmune thyroid disease     109562656   09171 Infectious disease: bacterial    05152 Tuberculosis     109562656   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562656    05161 Hepatitis B     109562656    05160 Hepatitis C     109562656    05171 Coronavirus disease - COVID-19     109562656    05164 Influenza A     109562656    05162 Measles     109562656    05168 Herpes simplex virus 1 infection     109562656    05163 Human cytomegalovirus infection     109562656    05167 Kaposi sarcoma-associated herpesvirus infection     109562656    05169 Epstein-Barr virus infection     109562656    05165 Human papillomavirus infection     109562656  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562656 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562656 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562656 NCBI-ProteinID:  XP_019821243 UniProt:  A0A6P5C6Z2 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFA FPQEALHGSQLQKAQAISVLHEVTQHTFQLFSTEGSDATWDESLLDKLRTALDQQLTDLQ ACLRQEEGLRGAPLLNEDSSLAVRKYFHRLTLYLQEKRHRPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaatgccatctgc tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgcatggcagccagttgcagaaggctcaggccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctctgatgccacgtgg gacgagagcctcctggacaagctccgcactgcactagatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaacgaggactccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacaga ccttgtgcctgggaggttgttagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

Bos indicus (zebu cattle): 109562659 Help Entry 109562659         CDS       T04792                                  Definition (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562659    04151 PI3K-Akt signaling pathway     109562659   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562659  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562659  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562659    04621 NOD-like receptor signaling pathway     109562659    04622 RIG-I-like receptor signaling pathway     109562659    04623 Cytosolic DNA-sensing pathway     109562659    04650 Natural killer cell mediated cytotoxicity     109562659  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562659   09163 Immune disease    05320 Autoimmune thyroid disease     109562659   09171 Infectious disease: bacterial    05152 Tuberculosis     109562659   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562659    05161 Hepatitis B     109562659    05160 Hepatitis C     109562659    05171 Coronavirus disease - COVID-19     109562659    05164 Influenza A     109562659    05162 Measles     109562659    05168 Herpes simplex virus 1 infection     109562659    05163 Human cytomegalovirus infection     109562659    05167 Kaposi sarcoma-associated herpesvirus infection     109562659    05169 Epstein-Barr virus infection     109562659    05165 Human papillomavirus infection     109562659  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562659 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562659 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562659 NCBI-ProteinID:  XP_019821246 UniProt:  A0A6P5C6J7 LinkDB All DBs Position 8 AA seq 198 aa AA seqDB search MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLTLLRQXRRVSPSSCLQDRNDFA FPQEALHGSQLQKAQAISVLHEVTQHTFQLFSTEGSATTWDESLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDASLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTN LQERFRRKDRHTPGSTQK NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaatgccatctgc tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgacgctc ctgcgacaamtgagaagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgcatggcagccagttgcagaaggctcaggccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccaccacgtgg gacgagagcctcctggacaagctccgagctgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggatgccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcttcctcaaccaac ttgcaggagagattcaggagaaaggacagacacacacctggttcaacacagaaatga

Bos indicus (zebu cattle): 109562660 Help Entry 109562660         CDS       T04792                                  Definition (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562660    04151 PI3K-Akt signaling pathway     109562660   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562660  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562660  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562660    04621 NOD-like receptor signaling pathway     109562660    04622 RIG-I-like receptor signaling pathway     109562660    04623 Cytosolic DNA-sensing pathway     109562660    04650 Natural killer cell mediated cytotoxicity     109562660  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562660   09163 Immune disease    05320 Autoimmune thyroid disease     109562660   09171 Infectious disease: bacterial    05152 Tuberculosis     109562660   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562660    05161 Hepatitis B     109562660    05160 Hepatitis C     109562660    05171 Coronavirus disease - COVID-19     109562660    05164 Influenza A     109562660    05162 Measles     109562660    05168 Herpes simplex virus 1 infection     109562660    05163 Human cytomegalovirus infection     109562660    05167 Kaposi sarcoma-associated herpesvirus infection     109562660    05169 Epstein-Barr virus infection     109562660    05165 Human papillomavirus infection     109562660  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562660 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562660 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562660 NCBI-ProteinID:  XP_019821247 UniProt:  A0A6P5C817 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCIAICSLGCHLPHTHSLPNRRVLTLLRQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAVWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDASLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQEKFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccctcctcctggccctgctgctgctcagctgcatcgccatctgc tctttgggttgccacctgcctcacacccacagcctgcccaacaggagggtcctgacactc ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgactttgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgctgtgtgg gaccagagcctcctggacaagctccgagctgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggatgccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcttcaacaaac ttgcaggagaaattcaggagaaaggactga

Bos indicus (zebu cattle): 109562665 Help Entry 109562665         CDS       T04792                                  Definition (RefSeq) interferon alpha-B-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562665    04151 PI3K-Akt signaling pathway     109562665   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562665  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562665  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562665    04621 NOD-like receptor signaling pathway     109562665    04622 RIG-I-like receptor signaling pathway     109562665    04623 Cytosolic DNA-sensing pathway     109562665    04650 Natural killer cell mediated cytotoxicity     109562665  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562665   09163 Immune disease    05320 Autoimmune thyroid disease     109562665   09171 Infectious disease: bacterial    05152 Tuberculosis     109562665   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562665    05161 Hepatitis B     109562665    05160 Hepatitis C     109562665    05171 Coronavirus disease - COVID-19     109562665    05164 Influenza A     109562665    05162 Measles     109562665    05168 Herpes simplex virus 1 infection     109562665    05163 Human cytomegalovirus infection     109562665    05167 Kaposi sarcoma-associated herpesvirus infection     109562665    05169 Epstein-Barr virus infection     109562665    05165 Human papillomavirus infection     109562665  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562665 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562665 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562665 NCBI-ProteinID:  XP_019821252 UniProt:  A0A6P5C821 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSFLLSLLLLSCNAICSLGCHLPHSYSLPNRRVLMLLRQLRRVSPSSCLQDRNDFA FPQEALGSSQLQKAQAISVLHEVTQHTFQLFSTEGSAATWDESLLDKLHAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRJTLYLREKRHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctcctgtccctgctgctgctcagctgcaatgccatctgc tctctgggctgccacctgcctcactcctacagcctgcccaacaggagggtcctgatgctc ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccacaggaggcgctgggtagcagccagttgcaaaaggctcaagccatctctgtgctc cacgaggtgacccagcacacsttccagctcttcagcacagagggctcggctgccacgtgg gacgagagcctcctggacaagctccacgctgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggattccagc ctggctgtgaggaaatacttccacagamtcactctctatctgcgagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

Bos indicus (zebu cattle): 109562668 Help Entry 109562668         CDS       T04792                                  Definition (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562668    04151 PI3K-Akt signaling pathway     109562668   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562668  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562668  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562668    04621 NOD-like receptor signaling pathway     109562668    04622 RIG-I-like receptor signaling pathway     109562668    04623 Cytosolic DNA-sensing pathway     109562668    04650 Natural killer cell mediated cytotoxicity     109562668  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562668   09163 Immune disease    05320 Autoimmune thyroid disease     109562668   09171 Infectious disease: bacterial    05152 Tuberculosis     109562668   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562668    05161 Hepatitis B     109562668    05160 Hepatitis C     109562668    05171 Coronavirus disease - COVID-19     109562668    05164 Influenza A     109562668    05162 Measles     109562668    05168 Herpes simplex virus 1 infection     109562668    05163 Human cytomegalovirus infection     109562668    05167 Kaposi sarcoma-associated herpesvirus infection     109562668    05169 Epstein-Barr virus infection     109562668    05165 Human papillomavirus infection     109562668  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562668 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562668 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562668 NCBI-ProteinID:  XP_019821255 UniProt:  A0A6P5C6P5 LinkDB All DBs Position 8 AA seq 186 aa AA seqDB search MTLPVSVLLALVMLCSSPMCSLGCELPASHHSNLESFTXWSQMERLPVVSCLRDRTDFRF PQTLVXGTRLEKTEAIAVVHELLQQTFQLFSTTGSSAGRDESLLDRFLVGLDQQLEDLDT CLREGRTPEQSPLGSENSRLAVKSYFQRISVYLKEKEYSRCAWEVLSVEIRRCLVFASKL IGKLRK NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccctccctgtctctgtgctgctggccctggtgatgctctgctccagccccatgtgc tccctgggctgtgagctgcctgcgagccaccacagcaatctggaaagcttcacacrttgg agtcagatggagagactgcccgttgtgtcctgtctgagggacaggactgacttcagattt cctcagaccctggtgcakgggaccaggcttgagaagacagaagccatagctgttgtacat gagttgctccagcagaccttccagctcttcagcaccacaggctcttctgcaggtcgggac gagagcctcctggacagattcctcgtgggacttgatcagcagctggaagacttggacacg tgtctgagagagggaaggacaccrgaacagtcacctctagggagtgagaactccagattg gctgtgaagagttacttccagcgaatcagtgtgtatctcaaagagaaagaatacagccgc tgtgcctgggaggttctcagcgtggaaatcagaaggtgyttggtctttgccagcaagctc atcggaaaactcaggaaataa

Bos indicus (zebu cattle): 109562670 Help Entry 109562670         CDS       T04792                                  Definition (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562670    04151 PI3K-Akt signaling pathway     109562670   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562670  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562670  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562670    04621 NOD-like receptor signaling pathway     109562670    04622 RIG-I-like receptor signaling pathway     109562670    04623 Cytosolic DNA-sensing pathway     109562670    04650 Natural killer cell mediated cytotoxicity     109562670  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562670   09163 Immune disease    05320 Autoimmune thyroid disease     109562670   09171 Infectious disease: bacterial    05152 Tuberculosis     109562670   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562670    05161 Hepatitis B     109562670    05160 Hepatitis C     109562670    05171 Coronavirus disease - COVID-19     109562670    05164 Influenza A     109562670    05162 Measles     109562670    05168 Herpes simplex virus 1 infection     109562670    05163 Human cytomegalovirus infection     109562670    05167 Kaposi sarcoma-associated herpesvirus infection     109562670    05169 Epstein-Barr virus infection     109562670    05165 Human papillomavirus infection     109562670  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562670 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562670 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562670 NCBI-ProteinID:  XP_019821256 UniProt:  A0A6P5C6K7 LinkDB All DBs Position 8 AA seq 185 aa AA seqDB search MALLVXVLLALVMLCSSPTCSLGCELPSSHGNLESFTRWSQMERXPIVSCLRDRTDFRFP QTLVHGTRLEETEATAVVHELLQQTFQLFSTTGSSAGRDKSLLDRFLVGLDQQLEDLDTC LREGRTXEQSPLGSENSRLAVKSYFQRISVYLKEKEYSHCAWEVVSVEIRRCLVFANELI GKLRK NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atggccctcctcgtcwctgtgctgctggccctggtgatgctctgctccagccccacgtgc tccctgggctgtgagctgccttcgagccacggcaatctggaaagcttcacacgttggagt cagatggagagastgcccattgtgtcctgtctgagggacaggactgacttcagatttcct cagaccctggtgcatgggaccaggcttgaggagacagaagccacagctgttgtgcacgag ttgctccagcagaccttccagctcttcagcaccacrggctcttctgcaggtcgggacaag agcctcctggacagattcctcgtgggacttgatcagcagttggaggacctggacacgtgt ctgagggagggaaggacacyggaacagtcacctctagggagtgagaactccagattggct gtgaagagttacttccagcgaatcagtgtgtatctcaaagagaaagaatacagccactgt gcctgggaggttgtcagtgtggaaatcagaaggtgcttggtctttgccaatgagctcatt ggaaaactcaggaaataa

Bos indicus (zebu cattle): 109562673 Help Entry 109562673         CDS       T04792                                  Definition (RefSeq) interferon alpha-3-like   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562673    04151 PI3K-Akt signaling pathway     109562673   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562673  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562673  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562673    04621 NOD-like receptor signaling pathway     109562673    04622 RIG-I-like receptor signaling pathway     109562673    04623 Cytosolic DNA-sensing pathway     109562673    04650 Natural killer cell mediated cytotoxicity     109562673  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562673   09163 Immune disease    05320 Autoimmune thyroid disease     109562673   09171 Infectious disease: bacterial    05152 Tuberculosis     109562673   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562673    05161 Hepatitis B     109562673    05160 Hepatitis C     109562673    05171 Coronavirus disease - COVID-19     109562673    05164 Influenza A     109562673    05162 Measles     109562673    05168 Herpes simplex virus 1 infection     109562673    05163 Human cytomegalovirus infection     109562673    05167 Kaposi sarcoma-associated herpesvirus infection     109562673    05169 Epstein-Barr virus infection     109562673    05165 Human papillomavirus infection     109562673  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562673 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562673 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Acyl-CoA_dh_2 Motif Other DBs NCBI-GeneID:  109562673 NCBI-ProteinID:  XP_019821258 UniProt:  A0A6P5C708 LinkDB All DBs Position 8 AA seq 157 aa AA seqDB search MQSCEPPASQWPSPSLCCWPLVMLCSSPTCSLGCELPSSHHGNLESFTCWSQMERLPIVS CLRDRTDFRFPQTLVHGTRLEKTEATAAVHELLQQTFQLFSTTGSSAXRDESLLDRFLVG LDQKLEDLDTCLREGRTREQSPLGXENSRXAVKXYFQ NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgcagtcctgcgagcccccagcgtcccartggccctccccgtcactgtgctgctggccc ttggtgatgctctgctccagccccacgtgctccctgggctgtgagctgccttcgagccac cacggcaatctggaaagcttcacatgttggagtcagatggagagactgcccattgtgtcc tgtctgagggacaggactgacttcagatttcctcagaccctggtgcacgggaccaggctt gagaagacagaagccacagctgctgtgcacgagttgctccagcagaccttccagctcttc agcaccacgggctcttctgcagrtcgggacgagagcctcctggacagattcctcgtggga cttgatcagaagttggaggacctggacacgtgtctgagggagggaaggacacgggaacaa tcacctctagggartgagaactccagatwggctgtgaagcrttacttccagtga

Bos indicus (zebu cattle): 109562847 Help Entry 109562847         CDS       T04792                                  Definition (RefSeq) interferon alpha-H   KO K05414   interferon alpha Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04151   PI3K-Akt signaling pathway biu04217   Necroptosis biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04623   Cytosolic DNA-sensing pathway biu04630   JAK-STAT signaling pathway biu04650   Natural killer cell mediated cytotoxicity biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05162   Measles biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109562847    04151 PI3K-Akt signaling pathway     109562847   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109562847  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109562847  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109562847    04621 NOD-like receptor signaling pathway     109562847    04622 RIG-I-like receptor signaling pathway     109562847    04623 Cytosolic DNA-sensing pathway     109562847    04650 Natural killer cell mediated cytotoxicity     109562847  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109562847   09163 Immune disease    05320 Autoimmune thyroid disease     109562847   09171 Infectious disease: bacterial    05152 Tuberculosis     109562847   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109562847    05161 Hepatitis B     109562847    05160 Hepatitis C     109562847    05171 Coronavirus disease - COVID-19     109562847    05164 Influenza A     109562847    05162 Measles     109562847    05168 Herpes simplex virus 1 infection     109562847    05163 Human cytomegalovirus infection     109562847    05167 Kaposi sarcoma-associated herpesvirus infection     109562847    05169 Epstein-Barr virus infection     109562847    05165 Human papillomavirus infection     109562847  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109562847 Cytokines and growth factors [BR:biu04052]  Cytokines   Interferons    109562847 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  109562847 NCBI-ProteinID:  XP_019821438 UniProt:  A0A6P5C7M6 LinkDB All DBs Position 8 AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLRQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSXEGSAAVWDESLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLREKRHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcrcagagggctcagccgccgtgtgg gatgagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagactcactctctatctkcgagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcttcaacaaac ttgcaggagagattcaggagaaaggactga

DBGET integrated database retrieval system