KEGG   Bos indicus (zebu cattle): 109562667
Entry
109562667         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon beta-3-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562667
   04668 TNF signaling pathway
    109562667
   04151 PI3K-Akt signaling pathway
    109562667
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562667
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562667
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562667
   04621 NOD-like receptor signaling pathway
    109562667
   04622 RIG-I-like receptor signaling pathway
    109562667
   04623 Cytosolic DNA-sensing pathway
    109562667
   04650 Natural killer cell mediated cytotoxicity
    109562667
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562667
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562667
   05152 Tuberculosis
    109562667
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562667
   05161 Hepatitis B
    109562667
   05160 Hepatitis C
    109562667
   05171 Coronavirus disease - COVID-19
    109562667
   05164 Influenza A
    109562667
   05162 Measles
    109562667
   05168 Herpes simplex virus 1 infection
    109562667
   05163 Human cytomegalovirus infection
    109562667
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562667
   05169 Epstein-Barr virus infection
    109562667
   05165 Human papillomavirus infection
    109562667
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562667
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562667
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562667
NCBI-ProteinID: XP_019821254
UniProt: A0A6P5C6N5
LinkDB
Position
8
AA seq 186 aa
MTYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSAEVCQKLLGQLHSTPQHCLEARMDFQ
VPEEMNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLVELYGQMNRLQ
PIQKEIMQEQNFTMGDTTVLHLKKYYFNLVQYLESKEYNRCAWTVVRVQILTNFSFLMRL
TASLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgctccgattccagcaaaggcggagcgctgaggtgtgtcagaaa
ctcctggggcagttacattcaacgcctcaacattgcctcgaggccaggatggacttccag
gtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtcatc
tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg
tctgagaccatcattgaggacctccttgtggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcaggagcaaaacttcaccatgggggacacaaccgttctt
cacctgaagaagtattacttcaacctcgtgcagtacctggagtccaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgatgagacta
acagcttccctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562671
Entry
109562671         CDS       T04792                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562671
   04668 TNF signaling pathway
    109562671
   04151 PI3K-Akt signaling pathway
    109562671
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562671
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562671
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562671
   04621 NOD-like receptor signaling pathway
    109562671
   04622 RIG-I-like receptor signaling pathway
    109562671
   04623 Cytosolic DNA-sensing pathway
    109562671
   04650 Natural killer cell mediated cytotoxicity
    109562671
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562671
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562671
   05152 Tuberculosis
    109562671
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562671
   05161 Hepatitis B
    109562671
   05160 Hepatitis C
    109562671
   05171 Coronavirus disease - COVID-19
    109562671
   05164 Influenza A
    109562671
   05162 Measles
    109562671
   05168 Herpes simplex virus 1 infection
    109562671
   05163 Human cytomegalovirus infection
    109562671
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562671
   05169 Epstein-Barr virus infection
    109562671
   05165 Human papillomavirus infection
    109562671
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562671
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562671
SSDB
Motif
Pfam: Interferon DUF2154
Other DBs
NCBI-GeneID: 109562671
NCBI-ProteinID: XP_019821257
UniProt: A0A6P5C827
LinkDB
Position
8
AA seq 186 aa
MTHRCLLPMVLLLCFSTTALSRSYSLLQFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ
MPEEMKQEQQFRKEDAILVMYEMLQHIFGILTRDFSXTGWSETIIEDLLEELYGQINRLE
PIQKEIMQKQNFTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLMRL
TDYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccgttgcctcctcccaatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcaattccaacaaaggcggagccttgcagtgtgtcagaaa
ctcctgtggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagaacagcagttccggaaggaagatgccatattggtcatg
tatgagatgctccagcacatcttcggcattctcaccagagacttctccarcactggctgg
tctgagaccatcatygaggacctccttgaggaactctatgggcagataaatcgtctggag
ccaatccaaaaggaaataatgcagaagcaaaatttcactatgggagacacaactgttctt
cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg
tgtgcctggacagtygtgcgagtgcaaatactcaggaacttttctttcctgatgagacta
acagattacctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562674
Entry
109562674         CDS       T04792                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562674
   04668 TNF signaling pathway
    109562674
   04151 PI3K-Akt signaling pathway
    109562674
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562674
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562674
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562674
   04621 NOD-like receptor signaling pathway
    109562674
   04622 RIG-I-like receptor signaling pathway
    109562674
   04623 Cytosolic DNA-sensing pathway
    109562674
   04650 Natural killer cell mediated cytotoxicity
    109562674
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562674
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562674
   05152 Tuberculosis
    109562674
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562674
   05161 Hepatitis B
    109562674
   05160 Hepatitis C
    109562674
   05171 Coronavirus disease - COVID-19
    109562674
   05164 Influenza A
    109562674
   05162 Measles
    109562674
   05168 Herpes simplex virus 1 infection
    109562674
   05163 Human cytomegalovirus infection
    109562674
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562674
   05169 Epstein-Barr virus infection
    109562674
   05165 Human papillomavirus infection
    109562674
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562674
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562674
SSDB
Motif
Pfam: Interferon SesA
Other DBs
NCBI-GeneID: 109562674
NCBI-ProteinID: XP_019821259
UniProt: A0A6P5C6P2
LinkDB
Position
8
AA seq 186 aa
MTHRCLLQMVLLLCFSTTALSRSYSLLRFQQRRSLAVCQKLLRQLPSTPQHCLEARMDFQ
MPEEMKQAQQFXKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLEELYEQMNRLE
PIQKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLTRL
TGYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcggtatgtcagaaa
ctcctgaggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagcacagcagttccrgaaggaagatgccatattggtcatc
tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg
tctgagaccatcatygaggacctccttgaggaactctatgagcagatgaatcgtctggag
ccaatccagaaggaaatcatgcagaagcaaaactccactatgggagacacgactgttctt
cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcaggaatttttctttcctgacgagacta
acaggttacctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562675
Entry
109562675         CDS       T04792                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562675
   04668 TNF signaling pathway
    109562675
   04151 PI3K-Akt signaling pathway
    109562675
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562675
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562675
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562675
   04621 NOD-like receptor signaling pathway
    109562675
   04622 RIG-I-like receptor signaling pathway
    109562675
   04623 Cytosolic DNA-sensing pathway
    109562675
   04650 Natural killer cell mediated cytotoxicity
    109562675
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562675
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562675
   05152 Tuberculosis
    109562675
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562675
   05161 Hepatitis B
    109562675
   05160 Hepatitis C
    109562675
   05171 Coronavirus disease - COVID-19
    109562675
   05164 Influenza A
    109562675
   05162 Measles
    109562675
   05168 Herpes simplex virus 1 infection
    109562675
   05163 Human cytomegalovirus infection
    109562675
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562675
   05169 Epstein-Barr virus infection
    109562675
   05165 Human papillomavirus infection
    109562675
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562675
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562675
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562675
NCBI-ProteinID: XP_019821260
UniProt: A0A6P5C6P9
LinkDB
Position
8
AA seq 186 aa
MTHRCLLQMVLLLCFSTTALSRSYSLLRFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ
MPEEMKQAQQFRKEDAILVIYEMLQQIFGILTRDFSSTGWSETIIEDLLEELYGQMNRLQ
PIQKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKXKEYNRCAWTVVRVQILRNFSFLTRL
TDXLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcagtgtgtcagaaa
ctcctgtggcagttaccgtcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccatattggtcatc
tatgagatgctccagcagatctttggcattctcaccagagacttctccagcactggctgg
tctgagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaatmatgcagaagcaaaactccactatgggagacacgactgttctt
cacctgaggaaatattacttcaacctcgtgcagtacctgaagtycaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcaggaatttttctttcctgacgagacta
acagattrcctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562852
Entry
109562852         CDS       T04792                                 

Definition
(RefSeq) interferon beta-2-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562852
   04668 TNF signaling pathway
    109562852
   04151 PI3K-Akt signaling pathway
    109562852
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562852
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562852
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562852
   04621 NOD-like receptor signaling pathway
    109562852
   04622 RIG-I-like receptor signaling pathway
    109562852
   04623 Cytosolic DNA-sensing pathway
    109562852
   04650 Natural killer cell mediated cytotoxicity
    109562852
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562852
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562852
   05152 Tuberculosis
    109562852
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562852
   05161 Hepatitis B
    109562852
   05160 Hepatitis C
    109562852
   05171 Coronavirus disease - COVID-19
    109562852
   05164 Influenza A
    109562852
   05162 Measles
    109562852
   05168 Herpes simplex virus 1 infection
    109562852
   05163 Human cytomegalovirus infection
    109562852
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562852
   05169 Epstein-Barr virus infection
    109562852
   05165 Human papillomavirus infection
    109562852
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562852
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562852
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562852
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562852
NCBI-ProteinID: XP_019821440
UniProt: A0A6P5C793
LinkDB
Position
8
AA seq 186 aa
MTHRCLLQMVLLLCFSTTALPRSYSLLGLQERRSAAVSQKLLRQLPSTPQRCLEARMDFQ
MPEEMKQAQQFQKEDAILVMYEMLQQIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLQ
PIQKEIMQKKNFTMGNTTVLHLKKYYLNLMYYLKSKEYNRCAWTVVRVQILTNFSFLKSL
TAYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
cccaggagctacagcttgcttggattgcaagaaaggcggagtgctgcggtctctcagaaa
ctcctgaggcagttaccttcaactcctcaacgttgcctcgaggccaggatggatttccag
atgcctgaggagatgaagcaagcacagcagttccagaaggaagatgccatattggtcatg
tatgagatgctccagcagatctttggcattcttaccagagatttctccagcactggctgg
tctgagaccatcatcgaggacctccttgtggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcagaagaaaaacttcactatgggaaacacaaccgttctt
cacctgaagaaatattacctcaacctcatgtactaccttaagtccaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgaagagccta
acagcttacctccgtgactga

KEGG   Bos indicus (zebu cattle): 109562853
Entry
109562853         CDS       T04792                                 

Definition
(RefSeq) interferon beta-1-like
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562853
   04668 TNF signaling pathway
    109562853
   04151 PI3K-Akt signaling pathway
    109562853
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562853
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562853
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562853
   04621 NOD-like receptor signaling pathway
    109562853
   04622 RIG-I-like receptor signaling pathway
    109562853
   04623 Cytosolic DNA-sensing pathway
    109562853
   04650 Natural killer cell mediated cytotoxicity
    109562853
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562853
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562853
   05152 Tuberculosis
    109562853
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562853
   05161 Hepatitis B
    109562853
   05160 Hepatitis C
    109562853
   05171 Coronavirus disease - COVID-19
    109562853
   05164 Influenza A
    109562853
   05162 Measles
    109562853
   05168 Herpes simplex virus 1 infection
    109562853
   05163 Human cytomegalovirus infection
    109562853
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562853
   05169 Epstein-Barr virus infection
    109562853
   05165 Human papillomavirus infection
    109562853
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562853
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562853
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562853
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 109562853
NCBI-ProteinID: XP_019821441
UniProt: A0A6P5C730
LinkDB
Position
8
AA seq 186 aa
MTYQCLLQMVLLLCFSTTALSRSYSLLRFQQSQSLKECQKLLGQLPSTPQHCLEARMDFQ
MPEEMKQEQQFQKEDAILVMYEMLQHIFGILTRDFSSTGWSETIIEDLLEELYGQMNRLQ
PIQKEIMQKQNSTTGDTIVPHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNVSFLMRL
TGYVRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccagtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaagtcagagccttaaagagtgtcagaaa
ctcctggggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagaacagcagttccagaaggaagatgccatattggtcatg
tatgagatgctccagcacatcttcggcattctcaccagagacttctccagcactggctgg
tctgagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcagaagcaaaactccactacgggagacacgatcgttccc
cacctagggaaatattacttcaacctcatgcagtacctggagtccaaggagtacgacagg
tgtgcctggacagtcgtgcaagtgcaaatactcacgaacgtttctttcctgatgagacta
acaggttacgtccgtgactga

KEGG   Bos indicus (zebu cattle): 109562855
Entry
109562855         CDS       T04792                                 

Definition
(RefSeq) interferon beta-1
  KO
K05415  interferon beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04668  TNF signaling pathway
biu05135  Yersinia infection
biu05142  Chagas disease
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109562855
   04668 TNF signaling pathway
    109562855
   04151 PI3K-Akt signaling pathway
    109562855
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109562855
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109562855
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109562855
   04621 NOD-like receptor signaling pathway
    109562855
   04622 RIG-I-like receptor signaling pathway
    109562855
   04623 Cytosolic DNA-sensing pathway
    109562855
   04650 Natural killer cell mediated cytotoxicity
    109562855
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109562855
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109562855
   05152 Tuberculosis
    109562855
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109562855
   05161 Hepatitis B
    109562855
   05160 Hepatitis C
    109562855
   05171 Coronavirus disease - COVID-19
    109562855
   05164 Influenza A
    109562855
   05162 Measles
    109562855
   05168 Herpes simplex virus 1 infection
    109562855
   05163 Human cytomegalovirus infection
    109562855
   05167 Kaposi sarcoma-associated herpesvirus infection
    109562855
   05169 Epstein-Barr virus infection
    109562855
   05165 Human papillomavirus infection
    109562855
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109562855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109562855
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109562855
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 109562855
NCBI-ProteinID: XP_019821442
UniProt: A0A6P5C8J0
LinkDB
Position
8
AA seq 186 aa
MTYRCLLQMVLLLCFSTTALSRSYSLLRFQQSQSLKECQKLLGQLPSTPQHCLEARMDFQ
MPEEMKQEQQFQKEDAILVMYEVLQHIFGILTRDFSSTGWSETIIEDLLKELYWQMNRLQ
PIQKEIMQKQNSTTGDTIVPHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNXSFLMRL
TGYVRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacctaccgrtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaagtcagagccttaaagagtgtcagaaa
ctcctggggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaagcaagaacagcagttccagaaggaagatgccatattggtcatg
tatgaggtgctccagcacatcttyggcattctcaccagagacttctccagcactggctgg
tctgagaccatcatcgaggacctccttaaggaactctattggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcagaagcaaaactccactacgggagacacgatcgttccc
cacctagggaaatattacttcaacctcatgcagtacctggagtccaaggagtacgacagg
tgtgcctggacagtcgtgcaagtgcaaatactcacgaacktttctttcctgatgagacta
acaggttacgtccgtgactga

DBGET integrated database retrieval system