KEGG   Bos indicus (zebu cattle): 109562672
Entry
109562672         CDS       T04792                                 

Gene name
DLG1
Definition
(RefSeq) disks large homolog 1
  KO
K12076  disks large protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04390  Hippo signaling pathway
biu04530  Tight junction
biu04660  T cell receptor signaling pathway
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109562672 (DLG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109562672 (DLG1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109562672 (DLG1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109562672 (DLG1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109562672 (DLG1)
   05165 Human papillomavirus infection
    109562672 (DLG1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109562672 (DLG1)
SSDB
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_assoc PDZ_6 PDZ_2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 109562672
NCBI-ProteinID: XP_019821261
UniProt: A0A6P5C6L2
LinkDB
Position
1
AA seq 875 aa
MPVRKQDTQRALHLLEDYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDHSKQSEPIQPVNTWEISSLPSTTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPVKPTEAVSPSSPTVPVIPVLP
VPAENTVILPIIPQANPPPVLVNTDSLETSTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIIAGGAAAQDGRLRVNDCILRVNEIDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKAFTTEEVEIVRNGRRQDKSSNSQGCLVSKQPRP
SGKVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPIDNH
VSPPSYLVQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIF
ISFILAGGPADLSGELRKGDRIISVNSVDLRTASHEQAAAALKNAGQAVTIVAQYRPEEY
SRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFG
DILHVINASDDEWWQARQVTPDGESDEVGVIPSKRSFNDREFCYFLLTGHNTVSDMATHY
HCLVVYIYFINYSSILHIIVTCNLCYIELYKTVLQVANGFLVPFNIKHFKFFFIKDTTRP
KRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILD
VSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFT
AIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEKL
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgccggtccggaagcaagatacccagagagcattgcaccttttggaagattatcgttcg
aaactaagccaaacagaagacagacagctcagaagttccatagaacgggttattaacata
ttccagagcaacctctttcaggctttaatagatattcaagaattttatgaagtgacctta
ctggataatccaaaatgtatagatcattcaaagcagtctgaaccaatacagcctgtaaat
acttgggaaatttccagccttccaagcactactgtgacttcagaaacactgccaagcagc
cttagccctagtgtagagaaataccggtatcaggatgaagatacacctcctcaagagcac
atttctccacaaatcactaatgaggtgataggtccagaattggttcatgtctcagagaag
aacctgtcagaaattgaaaacgtccatggatttgtttctcactctcatatttcaccagta
aagccaacagaagctgtatctccctcttctcccactgtccctgtgatccctgtcctgcca
gtccctgctgagaatactgtcatcctacccatcataccacaggcaaatcctcctccagta
ctagtcaacacagacagcttggaaacatcaacttatgttaatggcactgatgcagattat
gaatatgaagaaatcacacttgaaaggggaaattcagggcttggtttcagcattgcagga
ggtacagacaacccacacattggagatgactcaagtattttcattactaaaattattgca
gggggagcagctgcccaagatggaagattgcgagtcaatgactgtattttgcgagtaaat
gaaatagatgttcgtgatgtaacacatagcaaagcagttgaagccttgaaagaagcagga
tctattgtacgcttgtatgtaaaaagacggaaaccagtatcagaaaaaataatggagata
aagctcattaaaggtcctaaagcctttactacagaagaggttgaaatagttcgtaatggt
aggagacaagataagagtagcaatagccagggctgtcttgtaagcaagcagccaaggcct
agtgggaaggtgaatagtgtgtgtttagaagaagttactcatgaagaagcagtaactgcc
ttaaagaacacatctgattttgtttatttgaaagtggcaaaacccacaagtatgtatatg
aatgatggctatgcaccacctgatatcaccaactcttcttctcagcctatcgataaccat
gttagcccaccttcctacttggtccagacaccagcatcaccagccagatattcacctgtt
tctaaagcagtacttggagatgatgaaattacgagggaacctagaaaagttgttcttcat
cgtggttcaacaggccttggtttcaacattgtaggaggtgaagatggagaaggaatattt
atctcctttattttggctggaggacctgccgatcttagtggagagctcagaaaaggagat
cgtattatatcggtaaacagtgttgacctcagaactgccagccatgagcaggcagcagct
gctttaaaaaatgctggccaagctgtcacaattgttgcacagtaccgacctgaagaatac
agtcgttttgaagccaaaatacatgacttacgggagcagatgatgaatagtagcattagt
tcaggttcaggttctcttcgaactagccagaagcgatccctctatgtcagggccctcttt
gattatgacaagactaaagacagtggccttcctagtcagggattgaacttcaaatttgga
gatatcctccatgttattaatgcttctgatgatgaatggtggcaagccagacaggttaca
ccagatggtgaaagtgatgaagttggggtgattcccagtaaacgcagttttaatgataga
gaattctgttattttctgttgaccggtcataatacggtgagtgatatggcaacacattac
cattgtttagtggtttatatttactttattaattattcctccatccttcatattattgtc
acttgcaatctctgttacattgaactttacaaaacagttcttcaagtagcaaatggattt
cttgtgccttttaatattaaacacttcaagttcttttttattaaagatacaactagacca
aaacgagattatgaggtggatggaagagattatcattttgtgacttcaagagaacaaatg
gaaaaagatatccaggaacataaattcattgaagctggccagtataataaccatctgtat
ggaacaagtgttcagtctgtgcgagaagtagcagaaaagggcaaacactgtatccttgat
gtgtctggaaatgctataaagagattacagattgcacaactttacccaatctccattttt
attaaacccaaatccatggaaaatatcatggaaatgaataagcgtctgacagaagaacaa
gccagaaagacatttgagagagccatgaaactggaacaagaatttactgaacatttcaca
gctattgtgcagggagatacgctggaagacatttacaaccaagtgaagcagatcatagaa
gaacagtctggtccttacatttgggttccagcaaaagaaaagttatga

DBGET integrated database retrieval system