KEGG   Bos indicus (zebu cattle): 109562775
Entry
109562775         CDS       T04792                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3
  KO
K02353  segment polarity protein dishevelled
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04330  Notch signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109562775 (DVL3)
   04330 Notch signaling pathway
    109562775 (DVL3)
   04390 Hippo signaling pathway
    109562775 (DVL3)
   04150 mTOR signaling pathway
    109562775 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109562775 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109562775 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109562775 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109562775 (DVL3)
   05226 Gastric cancer
    109562775 (DVL3)
   05217 Basal cell carcinoma
    109562775 (DVL3)
   05224 Breast cancer
    109562775 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109562775 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    109562775 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109562775 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109562775 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 109562775
NCBI-ProteinID: XP_019821354
UniProt: A0A6P5C700
LinkDB
Position
1
AA seq 753 aa
MQYALHILQRSSRSPWVQSQGLEESGNPAILERSIHPAPGGVGDRRHATPGPGTRAQEPS
LRVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSH
PEPAAFCADSPAELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRER
PRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSST
EQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIV
GQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHK
PGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTIT
STSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGS
DVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLS
LHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYGGGSA
SSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERS
GPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGR
DLASVPPELTASRQSFRMAMGNPTKNFGLFDFL
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgcagtatgccttgcacatactgcagaggagcagccgatccccttgggtccagagccag
ggccttgaagagtccggaaacccggccatcctggagagatctatccatccagcccctggg
ggcgtaggcgaccgccgccacgctacccccgggcctgggaccagagcgcaggagccgagc
ctgcgcgtcaccttggcggactttaagggcgttctgcaacgacccagctataagttcttc
ttcaagtctatggacgacgatttcggagtggtgaaggaggagatctcggacgacaatgcc
aagctgccctgcttcaatggccgggtggtgtcctggctggtgtcggctgaaggctcacac
ccagaaccagcagccttctgtgctgacagcccggcagaactgccaccgcccatggagcgc
acaggaggcattggcgactcccggcccccatccttccaccctcacgctggtgggggcagc
caggagaacctggacaatgacacagagactgactccttggtgtctgcccagcgagagcgg
ccacgccggagggatggcccagagcacacaacccggctgaatggaactgccaagggggag
cggcgacgagagccagggggttatgacagctcctccaccctgatgagcagcgagttggag
accaccagcttctttgattcagatgaggatgattccaccagcaggttcagcagctccaca
gagcagagcagcgcctcacgcctgatgagaagacacaagcggcggcggcggaagcagaag
gtttcccggattgagcggtcttcgtccttcagcagcatcacggactccaccatgtcactc
aacatcatcaccgtcactctcaacatggaaaagtataacttcttgggcatctccatcgtg
ggccaaagcaacgagcgtggtgatggaggcatctacatcggctccatcatgaagggtggg
gccgtggctgctgatggacgcattgagccaggagacatgctgttacaggtaaacgagatc
aactttgagaacatgagtaacgatgacgcagtccgagtacttcgggaaattgtgcacaaa
ccagggcccatcaccttgactgtagccaagtgctgggacccaagtccacgtgggtgcttc
acactgcccaggagtgagcccatccggcccattgaccccgcggcctgggtctcccacact
gcagccatgaccggcaccttccctgcctacggcatgagcccttccctgagcaccatcacc
tccaccagctcctccatcaccagctccatccctgacacagagcgcctagacgacttccac
ctgtccatccacagtgacatggctgccatagtaaaagccatggcctcccctgaatccggg
ctagaggtccgtgaccgaatgtggctcaagattaccattcccaacgctttcatcggctcg
gatgtggtggactggctgtaccacaacgtggaaggcttcactgaccggcgagaggcccgc
aagtatgccagcaacctgctgaaagctggcttcatccgccacactgtcaacaagatcacc
ttctccgagcagtgctactacatcttcggcgacctctgtggcaacatggccaacctctcc
ctccacgatcacgacggctccagcggcgcctccgaccaggacacgctggcccctctgccg
cacccaggggccgctccttggcccatggctttcccttaccagtacccgccgcccccacac
ccctacaatccgcacccaggcttcccagagctggggtacagctatggcgggggcagcgcc
agtagtcagcacagtgaaggcagccggagcagtgggtccaatcgtagcggcagcgaccgg
cggaaggagaaggaccctaaggccggggactcgaagtcgggcggcagtggcagcgaatcg
gaccacacgacccgcagcagtctgcgggggccgcgggagcgggcgcccagcgagcgctcg
ggtcctgccgccagcgagcatagccaccgcagccaccactcgctggccagcagcctgcgc
agccatcacacgcacccaagctacggcccccctggggtgccccctctctacgggcccccc
atgttgatgatgcccccaccgcccgcggccatggggcccccgggagcccctccgggccgc
gacctggcctctgtgccccccgaactgaccgccagcagacagtccttccgcatggccatg
ggaaaccccaccaagaatttcgggctgtttgactttctgtga

KEGG   Bos indicus (zebu cattle): 109570328
Entry
109570328         CDS       T04792                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04330  Notch signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109570328 (DVL1)
   04330 Notch signaling pathway
    109570328 (DVL1)
   04390 Hippo signaling pathway
    109570328 (DVL1)
   04150 mTOR signaling pathway
    109570328 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109570328 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109570328 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570328 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109570328 (DVL1)
   05226 Gastric cancer
    109570328 (DVL1)
   05217 Basal cell carcinoma
    109570328 (DVL1)
   05224 Breast cancer
    109570328 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570328 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    109570328 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109570328 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109570328 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 109570328
NCBI-ProteinID: XP_019831742
UniProt: A0A6P5D441
LinkDB
Position
16
AA seq 728 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDGHTDLPPPLERTGGIGDSRPPSF
HPNVAGSRDGMDNETGTESLVSHRRERARRRNREEARTNGHPRGDRRRDLGLPPDSASTV
LSSELESSSFIDSDEDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFSSIT
DSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDML
LQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDPA
AWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVRV
MQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYAHLEGFRERREARKYASSMLKRGFLR
HTVNKVTFSEQCYYVFGDLCSSEWGCGVESQKGRPPSPPSPALPLPSPLADLAALNLNSG
SSGASDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFGYGSGSAGSQQSEG
SKSSGSTRSAGGSSRRALGREKESRSAGAGGSGSESDHTAPSGAGGSGWRERPPSQLSRG
SSPRSQASAAAPGLPPLHPLTKAYSVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNP
CEFFVDIM
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctatcacatggatgaggaggagacgccgtacctggtcaag
ctgccggtggcgcccgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttcttcaagtccatggaccaggacttcggggttgtaaag
gaggagatctctgacgataatgccaagctgccctgcttcaacggccgtgtggtctcctgg
ctggttctggctgagggtgctcactcggatgcagggtctcagggcactgatggacacaca
gacctgcccccgcctcttgagcggacaggtggcatcggggactcccggcctccctccttc
cacccgaatgtggccggcagccgcgatgggatggataacgagactggcacggagtcactg
gtcagccaccggcgggagcgagcccgacgccggaaccgtgaagaggcccggaccaacggg
cacccaaggggggaccggcggcgggacctggggctgccccctgacagtgcgtccaccgtg
ctgagcagtgaacttgagtccagcagcttcatcgactcggatgaagatgacaacacaagc
cggctgagtagctccacggagcagagcacctcctccaggctcatccggaaacacaagcgc
cggcggcggaaacagcgcctgcggcagacagaccgggcctcctctttcagcagcatcacg
gactccaccatgtccctcaacatcatcaccgtcacactcaacatggagaggcaccacttc
ctgggcatcagcatcgtgggccagagcaatgaccggggcgacggtggcatctacatcggc
tccatcatgaagggtggggctgttgctgctgatggccgcatcgagccaggcgacatgctg
ctgcaggtgaacgacgtcaacttcgagaacatgagcaacgatgatgctgtgcgagtcctg
cgggagatcgtgtcccagacggggcccatcagcctcacggtggccaagtgctgggaccca
acgccccgcagctacttcaccatcccgagggcggatccagttcggcccatcgacccagct
gcctggctgtcccacacggcagcattgacgggagccctgccccgctatggtacgagcccc
tgctccagcgccgtcacgcgcaccagctcctcctcactaaccagctctgtgcctggcgct
ccgcagctggaggaggcgccgctgacggtgaagagcgacatgggtgctgttgtccgggtc
atgcagctkccggactcgggcctggaaatccgggaccgcatgtggctcaagatcaccatc
gccaatgccgtcatcggggcagatgtggtggactggctgtacgcgcacctggagggcttc
cgcgagcggcgggaggcgcgcaagtacgccagcagcatgctgaagcgtggcttcctgcgg
cacacagtcaacaaggtcaccttctcagagcagtgctactacgtcttcggggacctgtgc
agcagtgagtggggctgcggagtggagtcccagaagggaaggccgccctccccaccctca
cccgcactccctctgccctcccctctcgcagatcttgccgccctgaacctcaacagtggc
tctagtggggcttctgatcaggacacgctggccccactgccccacccggctgccccctgg
cctctgggtcagggctacccctaccagtacccagggcccccgccctgcttcccgcctgca
tatcaggaccctggcttcggctacggcagcggcagtgctgggagtcagcagagtgaagga
agcaaaagcagtgggtccacccggagtgctggcgggagcagccgtcgggccttgggccgc
gagaaggagagccggtcggctggagctgggggcagtggcagcgagtcagaccacacagcg
ccaagcggggcgggtggcagtggctggcgggagcgtccccctagccagctcagccgtggc
agcagcccacgcagccaggcctcagccgccgccccagggctccccccgctgcaccccctg
acaaaggcctactcagtggtgggtgggccacctggggggccacctgtccgggagctggcc
gctgtcccgccagagctgacgggcagccgccagtccttccaaaaggccatggggaacccc
tgtgagttcttcgtggatatcatgtga

KEGG   Bos indicus (zebu cattle): 109573933
Entry
109573933         CDS       T04792                                 

Gene name
DVL2
Definition
(RefSeq) LOW QUALITY PROTEIN: segment polarity protein dishevelled homolog DVL-2
  KO
K02353  segment polarity protein dishevelled
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04150  mTOR signaling pathway
biu04310  Wnt signaling pathway
biu04330  Notch signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04916  Melanogenesis
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109573933 (DVL2)
   04330 Notch signaling pathway
    109573933 (DVL2)
   04390 Hippo signaling pathway
    109573933 (DVL2)
   04150 mTOR signaling pathway
    109573933 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109573933 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109573933 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573933 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109573933 (DVL2)
   05226 Gastric cancer
    109573933 (DVL2)
   05217 Basal cell carcinoma
    109573933 (DVL2)
   05224 Breast cancer
    109573933 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109573933 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    109573933 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109573933 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109573933 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 109573933
NCBI-ProteinID: XP_019837092
UniProt: A0A6P5DIR1
LinkDB
Position
19
AA seq 736 aa
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRTDLAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPS
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERASSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEDRAPESKSGSGSESEPSSRGGSLRRGGEPGGTGDGGPPPSRGSSGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcggcgcggggggcggtggtgttggggagacgaaggtaatttaccacctg
gatgaagaagagactccctatctggtgaagatccccgtccccgccgagcgcatcaccctt
ggcgatttcaagagcgtcttgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaagagatttcagatgacaatgcccgccttccctgc
ttcaatggaagggtagtatcctggctagtgtcatcagataacccccaacctgagatggcg
cccccagcccacgagcctcggacagacctggcgcctccacccccacctctgccccctctg
cccccagagaggaccagtggcattggggactccaggcctccatctttccaccctaacgtg
tccagcagccgggaaaacctggagccygagacagaaacagagtcagtggtgtctctgagg
cgggagcggcctcgcaggcgagacagcagtgagcatggcgcgggaggccacaggcccagc
ggcccctccaggctggagcgccacctggcggggtacgagagctcctccaccctcatgacc
agtgagctggagagcaccagcctgggggactcggacgaggacgacaccatgagcaggttc
agcagctccacagagcagagcagcgcctcccgcctcctcaagcgccaccggcggcgaagg
aaacagcggccaccccgcctggagagggcctcatccttcagcagtgtcacagattccacc
atgtctctcaacatcatcacagtcacgctcaacatggaaaagtacaatttcctgggcatc
tctattgtgggccagagcaatgagaggggagacggtggcatctacattggctccatcatg
aaaggtggggctgtggcggctgatgggcgcatcgaacctggggacatgcttttgcaggtg
aacgacatgaactttgagaatatgagcaatgatgatgcggtgcgggtgctgagggacatc
gtgcacaagccaggccccattgtgctgacggtggccaagtgctgggatccctctccccag
gcctacttcactctcccccgaaatgagcccatccagccgatcgaccctgctgcctgggtc
tcacactctgctgccctgactggcaccttcccagcttatccaggctcctcatccatgagt
accatcacctctggatcctctcttcctgatggctgtgagggccggggtctctctatccac
acagacatggcgtctgtgaccaaggccatggctgctccagaatcgggactggaagttcgg
gaccgcatgtggctcaagatcaccatccctaacgccttcctgggctcggatgtggtggac
tggctgtaccatcacgtggagggctttccggagcggcgggaggcccggaagtacgccagt
gggctactcaaggcgggcctcatccggcacactgtgaacaagatcaccttctctgagcag
tgctattacgtcttcggagacctcagtggtggctgtgagagctacttagtcaacttatct
cttaatgacaatgatggctccagtggtgcttcggaccaggatactttggctcctctgcct
ggggccaccccctggcccctattgcccactttctcataccagtacccagccccacaccca
tacagtcctcagcccccaccctaccacgagctctcgtcctacacctatggcggaggcagt
gccagcagccagcacagcgaggggagccggagcagtgggtcgacgcggagcgatgggggg
gcggggcgcacggggaggcctgaggatcgggcccctgagtccaagtccggcagtggcagt
gagtctgagccttccagccggggcggcagccttcgacggggtggggaacctggtgggact
ggtgatgggggccctcccccatccaggggctcatcagggggtgctcccaatctccgagcc
cacccggggctgcatccctatggcccacctcctggtatggccctcccttataaccccatg
atggtggtcatgatgccgccgcccccaccccctgtccctccagcagtgcagcctccaggg
gcccctccagtccgagacctgggctctgtgcccccagagttgaccgccagccgccaaagt
ttccacatggccatgggcaaccccagtgagttctttgtggatgtcatgtag

DBGET integrated database retrieval system