KEGG   Bos indicus (zebu cattle): 109563136Help
Entry
109563136         CDS       T04792                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu05200  Pathways in cancer
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109563136 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    109563136 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109563136 (NKX3-1)
Transcription factors [BR:biu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    109563136 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Homez
Motif
Other DBs
NCBI-GeneID: 109563136
NCBI-ProteinID: XP_019821926
LinkDB All DBs
Position
8
AA seq 239 aa AA seqDB search
MLRTPEPQLGNAGAAGCSPPAVPPTQTKPLTSFLIQDILRDGADRRGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXEDQQSDQPRAGSEEAEKPVETEPETYLLDCENPPSALQS
LPPATKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNR
RYKTKRKQLTSDLGNLEKHSSLPALKEEGFSQGSLISVHNTYPYYPYVYCLGGWSPAFW
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgctccggactcccgagccacagttggggaacgcgggggccgcgggctgcagccccccg
gctgtgccgcccacccagaccaagccgctcacctccttcctcatccaggacatccttcgg
gacggcgctgaccggcgcggagnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
ncggaggaccagcagagcgaccagccccgcgccggtagcgaggaggccgagaagccggtg
gagaccgagccagaaacttatctgctggactgtgaaaaccctcccagcgccttacagagc
ctacccccagccaccaagcagcctcagaagcgctcccgggctgccttctctcacactcag
gtcattgagttggagaggaagttcagccatcagaagtatctgtctgcccccgaaagggct
cacctggccaagaacctcaagctcacggagacccaagtgaaaatatggttccagaacaga
cgctataagaccaagcggaagcagctcacctcggacctgggcaacctggagaagcactct
tccttgccagctctcaaagaggagggcttctcacagggctccctcatctctgtgcacaat
acctacccttactacccctacgtttactgcctgggtggctggagtccagctttctggtaa

DBGET integrated database retrieval system